Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human MAGED1 Monoclonal Antibody | anti-MAGED1 antibody

MAGED1 (Melanoma-associated Antigen D1, MAGE-D1 Antigen, Neurotrophin Receptor-interacting MAGE Homolog, MAGE Tumor Antigen CCF, NRAGE, PRO2292, PP2250) (HRP)

Gene Names
MAGED1; NRAGE; DLXIN-1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAGED1; Monoclonal Antibody; MAGED1 (Melanoma-associated Antigen D1; MAGE-D1 Antigen; Neurotrophin Receptor-interacting MAGE Homolog; MAGE Tumor Antigen CCF; NRAGE; PRO2292; PP2250) (HRP); anti-MAGED1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E1
Specificity
Recognizes human MAGED1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2891
Applicable Applications for anti-MAGED1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa117-226 from MAGED1 (NP_001005333) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EMADIQVSAAAARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNAN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(MAGED1 monoclonal antibody Western Blot analysis of MAGED1 expression in Jurkat)

Western Blot (WB) (MAGED1 monoclonal antibody Western Blot analysis of MAGED1 expression in Jurkat)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MAGED1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MAGED1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml])
Product Categories/Family for anti-MAGED1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens MAGE family member D1 (MAGED1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
MAGE family member D1
NCBI Official Symbol
MAGED1
NCBI Official Synonym Symbols
NRAGE; DLXIN-1
NCBI Protein Information
melanoma-associated antigen D1

NCBI Description

This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on MAGED1

Similar Products

Product Notes

The MAGED1 (Catalog #AAA6153397) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAGED1 (Melanoma-associated Antigen D1, MAGE-D1 Antigen, Neurotrophin Receptor-interacting MAGE Homolog, MAGE Tumor Antigen CCF, NRAGE, PRO2292, PP2250) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGED1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAGED1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGED1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.