<
Testing Data
(Detection limit for recombinant GST tagged MAGEB1 is 0.1 ng/ml as a capture antibody.)
Mouse MAGEB1 Monoclonal Antibody | anti-MAGEB1 antibody
MAGEB1 (Melanoma Antigen Family B, 1, DAM10, MAGE-Xp, MAGEL1, MGC9322) (Biotin)
Gene Names
MAGEB1; CT3.1; DAM10; MAGEL1; MAGE-Xp; MGC9322
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
MAGEB1; Monoclonal Antibody; MAGEB1 (Melanoma Antigen Family B; 1; DAM10; MAGE-Xp; MAGEL1; MGC9322) (Biotin); Melanoma Antigen Family B; MGC9322; anti-MAGEB1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C1
Specificity
Recognizes MAGEB1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MAGEB1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MAGEB1 (NP_803134.1, 86aa-195aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged MAGEB1 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MAGEB1 is 0.1 ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of MAGEB1 expression in transfected 293T cell line by MAGEB1 monoclonal antibody (M09), clone 3C1.Lane 1: MAGEB1 transfected lysate (Predicted MW: 39 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MAGEB1 expression in transfected 293T cell line by MAGEB1 monoclonal antibody (M09), clone 3C1.Lane 1: MAGEB1 transfected lysate (Predicted MW: 39 KDa).Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to MAGEB1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to MAGEB1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to MAGEB1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to MAGEB1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-MAGEB1 antibody
This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region, and expressed in testis and in a significant fraction of tumors of various histological types. This gene and other MAGEB members are clustered on chromosome Xp22-p21. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene, however, the full length nature of some variants has not been defined. [provided by RefSeq]
Product Categories/Family for anti-MAGEB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,037 Da
NCBI Official Full Name
melanoma-associated antigen B1
NCBI Official Synonym Full Names
melanoma antigen family B, 1
NCBI Official Symbol
MAGEB1
NCBI Official Synonym Symbols
CT3.1; DAM10; MAGEL1; MAGE-Xp; MGC9322
NCBI Protein Information
melanoma-associated antigen B1; MAGE-B1 antigen; MAGE-XP antigen; OTTHUMP00000023101; cancer/testis antigen 3.1; cancer/testis antigen family 3, member 1; DSS-AHC critical interval MAGE superfamily 10; DSS/AHC critical interval MAGE superfamily 10
UniProt Protein Name
Melanoma-associated antigen B1
Protein Family
UniProt Gene Name
MAGEB1
UniProt Synonym Gene Names
MAGEL1; MAGEXP; CT3.1; DAM10
UniProt Entry Name
MAGB1_HUMAN
Uniprot Description
MAGE-B1:
Protein type: Cancer Testis Antigen (CTA)
Chromosomal Location of Human Ortholog: Xp21.3
Similar Products
Product Notes
The MAGEB1 mageb1 (Catalog #AAA6173701) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MAGEB1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAGEB1 mageb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGEB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
