Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MAGEA4 monoclonal antibody Western Blot analysis of MAGEA4 expression in Hela NE.)

Mouse anti-Human MAGEA4 Monoclonal Antibody | anti-MAGEA4 antibody

MAGEA4 (Melanoma-associated Antigen 4, MAGE-4 Antigen, MAGE-X2 Antigen, MAGE-41 Antigen, Cancer/Testis Antigen 1.4, CT1.4, MAGE4, MGC21336) (HRP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAGEA4; Monoclonal Antibody; MAGEA4 (Melanoma-associated Antigen 4; MAGE-4 Antigen; MAGE-X2 Antigen; MAGE-41 Antigen; Cancer/Testis Antigen 1.4; CT1.4; MAGE4; MGC21336) (HRP); anti-MAGEA4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D12
Specificity
Recognizes human MAGEA4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
317
Applicable Applications for anti-MAGEA4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa98-171 from human MAGEA4 (NP_002353) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAGEA4 monoclonal antibody Western Blot analysis of MAGEA4 expression in Hela NE.)

Western Blot (WB) (MAGEA4 monoclonal antibody Western Blot analysis of MAGEA4 expression in Hela NE.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MAGEA4 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MAGEA4 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MAGEA4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MAGEA4 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-MAGEA4 antibody
MAGEA4 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
Product Categories/Family for anti-MAGEA4 antibody
References
1. Heteroclitic serological response in esophageal and prostate cancer patients after NY?ESO?1 protein vaccination. Kawada J, Wada H, Isobe M, Gnjatic S, Nishikawa H, Jungbluth AA, Okazaki N, Uenaka A, Nakamura Y, Fujiwara S, Mizuno N, Saika T, Ritter E, Yamasaki M, Miyata H, Ritter G, Murphy R, Venhaus R, Pan L, Old LJ, Doki Y, Nakayama E.Int J Cancer. 2011 Mar 16. doi: 10.1002/ijc.26074.

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
melanoma-associated antigen 4
UniProt Protein Name
Melanoma-associated antigen 4
UniProt Gene Name
MAGEA4
UniProt Synonym Gene Names
MAGE4; CT1.4
UniProt Entry Name
MAGA4_HUMAN

Uniprot Description

MAGE-A4: a member of the MAGE (melanoma-associated antigen) family of Cancer-Testis Antigens (CTAs). May play a role in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovary cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. The MAGE family of proteins, encompassing 12 highly homologous genes clustered at Xq26-28, are tumor-specific antigens that can be recognized by autologous cytolytic T lymphocytes. MAGE proteins are characterized by the presence of a conserved domain (MHD, MAGE Homology Domain). MAGE-A4 expression is high in ovarian serous carcinoma, various squamous carcinomas, testicular germ cell tumors, oesophageal mucosal melanoma, and triple-negative breast cancers. Spontaneous humoral and cellular immune responses against MAGE-A4 have been detected in cancer patients. MAGE family proteins bind to and activate RING E3 ubiquitin ligases.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xq28

Molecular Function: protein binding

Similar Products

Product Notes

The MAGEA4 magea4 (Catalog #AAA6153393) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAGEA4 (Melanoma-associated Antigen 4, MAGE-4 Antigen, MAGE-X2 Antigen, MAGE-41 Antigen, Cancer/Testis Antigen 1.4, CT1.4, MAGE4, MGC21336) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEA4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAGEA4 magea4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGEA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.