Western Blot (WB)
(Western Blot detection against Immunogen (33.88kD).)
Mouse anti-Human MAGEA1 Monoclonal Antibody | anti-MAGEA1 antibody
MAGEA1 (Melanoma-associated Antigen 1, MAGE-1 Antigen, Antigen MZ2-E, Cancer/Testis Antigen 1.1, CT1.1, MAGE1, MGC9326) (AP)
Gene Names
MAGEA1; CT1.1; MAGE1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAGEA1; Monoclonal Antibody; MAGEA1 (Melanoma-associated Antigen 1; MAGE-1 Antigen; Antigen MZ2-E; Cancer/Testis Antigen 1.1; CT1.1; MAGE1; MGC9326) (AP); anti-MAGEA1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H5
Specificity
Recognizes human MAGEA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MAGEA1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa98-171 from human MAGEA1 (NP_004979) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (33.88kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (33.88kD).)
Testing Data
(Detection limit for recombinant GST tagged MAGEA1 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged MAGEA1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-MAGEA1 antibody
MAGEA1 is a member of the MAGEA gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 80% sequence identity between each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are expressed at a high level in a number of tumors of various histologic types, and are silent in normal tissues with the exception of testis and placenta. The MAGEA genes are clustered on chromosome Xq28. They may be implicated in some hereditary disorders, such as dyskeratosis congenita.
Product Categories/Family for anti-MAGEA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,342 Da
NCBI Official Full Name
melanoma-associated antigen 1
NCBI Official Synonym Full Names
melanoma antigen family A1
NCBI Official Symbol
MAGEA1
NCBI Official Synonym Symbols
CT1.1; MAGE1
NCBI Protein Information
melanoma-associated antigen 1; MAGE-1 antigen; antigen MZ2-E; cancer/testis antigen 1.1; cancer/testis antigen family 1, member 1; melanoma antigen MAGE-1; melanoma antigen family A 1; melanoma antigen family A, 1 (directs expression of antigen MZ2-E); me
UniProt Protein Name
Melanoma-associated antigen 1
Protein Family
UniProt Gene Name
MAGEA1
UniProt Synonym Gene Names
MAGE1; MAGE1A; CT1.1
UniProt Entry Name
MAGA1_HUMAN
Similar Products
Product Notes
The MAGEA1 magea1 (Catalog #AAA6132177) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAGEA1 (Melanoma-associated Antigen 1, MAGE-1 Antigen, Antigen MZ2-E, Cancer/Testis Antigen 1.1, CT1.1, MAGE1, MGC9326) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAGEA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAGEA1 magea1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAGEA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
