Mouse MAD2L1BP Monoclonal Antibody | anti-MAD2L1BP antibody

MAD2L1BP (MAD2L1 Binding Protein, CMT2, KIAA0110, MGC11282, RP1-261G23.6) (PE)

Cat. Num. AAA6186782

• Gene Names: MAD2L1BP; CMT2; KIAA0110; MGC11282; RP1-261G23.6
• Applications: ELISA, Immunoprecipitation
• Purity: Purified
• Synonyms: MAD2L1BP; Monoclonal Antibody; MAD2L1BP (MAD2L1 Binding Protein; CMT2; KIAA0110; MGC11282; RP1-261G23.6) (PE); MAD2L1 Binding Protein; RP1-261G23.6; anti-MAD2L1BP antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B9
• Specificity: Recognizes MAD2L1BP.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MAD2L1BP antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MAD2L1BP (NP_055443.1, 171aa-274aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of MAD2L1BP transfected lysate using anti-MAD2L1BP monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAD2L1BP MaxPab rabbit polyclonal antibody.)

Related Product Information for anti-MAD2L1BP antibody

The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Product Categories/Family for anti-MAD2L1BP antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7661918
• NCBI GeneID: 9587
• NCBI Accession #: NP_055443.1
• NCBI GenBank Nucleotide #: NM_014628.2
• UniProt Accession #: Q15013; Q6IBB1; B4DLV3
• Molecular Weight: 31,052 Da
• NCBI Official Full Name: MAD2L1-binding protein isoform 2
• NCBI Official Synonym Full Names: MAD2L1 binding protein
• NCBI Official Symbol: MAD2L1BP
• NCBI Official Synonym Symbols: CMT2; KIAA0110; MGC11282; RP1-261G23.6
• NCBI Protein Information: MAD2L1-binding protein; OTTHUMP00000016496; OTTHUMP00000221652; caught by MAD2 protein
• UniProt Protein Name: MAD2L1-binding protein
• Protein Family: MAD2L1-binding protein
• UniProt Gene Name: MAD2L1BP
• UniProt Synonym Gene Names: CMT2; KIAA0110
• UniProt Entry Name: MD2BP_HUMAN

NCBI Description

The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Uniprot Description

MAD2L1BP: May function to silence the spindle checkpoint and allow mitosis to proceed through anaphase by binding MAD2L1 after it has become dissociated from the MAD2L1-CDC20 complex. Belongs to the MAD2L1BP family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: intracellular membrane-bound organelle; cytoplasm; nucleolus; spindle; nucleus

Molecular Function: protein binding

Biological Process: mitotic cell cycle checkpoint; regulation of exit from mitosis