Mouse anti-Human MACF1 Monoclonal Antibody | anti-MACF1 antibody

MACF1 (Microtubule-actin Cross-linking Factor 1, Isoforms 1/2/3/5, 620kD Actin-binding Protein, ABP620, Actin Cross-linking Family Protein 7, Macrophin-1, Trabeculin-alpha, ABP620, ACF7, KIAA0465, KIAA1251) (MaxLight 650)

Cat. Num. AAA6223059

• Gene Names: MACF1; ACF7; LIS9; MACF; OFC4; ABP620
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MACF1; Monoclonal Antibody; MACF1 (Microtubule-actin Cross-linking Factor 1; Isoforms 1/2/3/5; 620kD Actin-binding Protein; ABP620; Actin Cross-linking Family Protein 7; Macrophin-1; Trabeculin-alpha; ACF7; KIAA0465; KIAA1251) (MaxLight 650); anti-MACF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G9
• Specificity: Recognizes human MACF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
• Sequence Length: 1364

• Applicable Applications for anti-MACF1 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-95 from MACF1 (AAH07330) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
• Conjugate: MaxLight650
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-MACF1 antibody

Isoform 2 is a F-actin-binding protein which may play a role in cross-linking actin to other cytoskeletal proteins and also binds to microtubules. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Acts as a positive regulator of Wnt receptor signaling pathway and is involved in the translocation of AXIN1 and its associated complex (composed of APC, CTNNB1 and GSK3B) from the cytoplasm to the cell membrane. Has actin-regulated ATPase activity and is essential for controlling focal adhesions (FAs) assembly and dynamics. May play role in delivery of transport vesicles containing GPI-linked proteins from the trans-Golgi network through its interaction with GOLGA4. Plays a key role in wound healing and epidermal cell migration. Required for efficient upward migration of bulge cells in response to wounding and this function is primarily rooted in its ability to coordinate MT dynamics and polarize hair follicle stem cells.

Product Categories/Family for anti-MACF1 antibody

Antibodies; Microtubule-associated Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 39644765
• NCBI GeneID: 23499
• NCBI Official Full Name: Homo sapiens microtubule-actin crosslinking factor 1, mRNA
• NCBI Official Synonym Full Names: microtubule actin crosslinking factor 1
• NCBI Official Symbol: MACF1
• NCBI Official Synonym Symbols: ACF7; LIS9; MACF; OFC4; ABP620
• NCBI Protein Information: microtubule-actin cross-linking factor 1
• Protein Family: Microtubule-actin cross-linking factor

NCBI Description

This gene encodes a large protein containing numerous spectrin and leucine-rich repeat (LRR) domains. The encoded protein is a member of a family of proteins that form bridges between different cytoskeletal elements. This protein facilitates actin-microtubule interactions at the cell periphery and couples the microtubule network to cellular junctions. Alternative splicing results in multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, May 2013]