Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Mouse anti-Human MACF1 Monoclonal Antibody | anti-MACF1 antibody

MACF1 (Microtubule-actin Cross-linking Factor 1, Isoforms 1/2/3/5, 620kD Actin-binding Protein, ABP620, Actin Cross-linking Family Protein 7, Macrophin-1, Trabeculin-alpha, ABP620, ACF7, KIAA0465, KIAA1251) APC

Gene Names
MACF1; ACF7; LIS9; MACF; OFC4; ABP620
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MACF1; Monoclonal Antibody; MACF1 (Microtubule-actin Cross-linking Factor 1; Isoforms 1/2/3/5; 620kD Actin-binding Protein; ABP620; Actin Cross-linking Family Protein 7; Macrophin-1; Trabeculin-alpha; ACF7; KIAA0465; KIAA1251) APC; anti-MACF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G9
Specificity
Recognizes human MACF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1364
Applicable Applications for anti-MACF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-95 from MACF1 (AAH07330) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Western Blot (WB)

(Western Blot analysis of MACF1 expression in transfected 293T cell line by MACF1 monoclonal antibody. Lane 1: MACF1 transfected lysate (10.45kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MACF1 expression in transfected 293T cell line by MACF1 monoclonal antibody. Lane 1: MACF1 transfected lysate (10.45kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MACF1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MACF1 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-MACF1 antibody
Isoform 2 is a F-actin-binding protein which may play a role in cross-linking actin to other cytoskeletal proteins and also binds to microtubules. Plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. Acts as a positive regulator of Wnt receptor signaling pathway and is involved in the translocation of AXIN1 and its associated complex (composed of APC, CTNNB1 and GSK3B) from the cytoplasm to the cell membrane. Has actin-regulated ATPase activity and is essential for controlling focal adhesions (FAs) assembly and dynamics. May play role in delivery of transport vesicles containing GPI-linked proteins from the trans-Golgi network through its interaction with GOLGA4. Plays a key role in wound healing and epidermal cell migration. Required for efficient upward migration of bulge cells in response to wounding and this function is primarily rooted in its ability to coordinate MT dynamics and polarize hair follicle stem cells.
Product Categories/Family for anti-MACF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens microtubule-actin crosslinking factor 1, mRNA
NCBI Official Synonym Full Names
microtubule actin crosslinking factor 1
NCBI Official Symbol
MACF1
NCBI Official Synonym Symbols
ACF7; LIS9; MACF; OFC4; ABP620
NCBI Protein Information
microtubule-actin cross-linking factor 1

NCBI Description

This gene encodes a large protein containing numerous spectrin and leucine-rich repeat (LRR) domains. The encoded protein is a member of a family of proteins that form bridges between different cytoskeletal elements. This protein facilitates actin-microtubule interactions at the cell periphery and couples the microtubule network to cellular junctions. Alternative splicing results in multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, May 2013]

Research Articles on MACF1

Similar Products

Product Notes

The MACF1 (Catalog #AAA6137474) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MACF1 (Microtubule-actin Cross-linking Factor 1, Isoforms 1/2/3/5, 620kD Actin-binding Protein, ABP620, Actin Cross-linking Family Protein 7, Macrophin-1, Trabeculin-alpha, ABP620, ACF7, KIAA0465, KIAA1251) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MACF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MACF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MACF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.