Mouse anti-Human LSM1 Monoclonal Antibody | anti-LSM1 antibody

LSM1 (U6 snRNA-associated Sm-like Protein LSm1, Cancer-associated Sm-like, Small Nuclear Ribonuclear CaSm, CASM) (FITC)

Cat. Num. AAA6148063

• Gene Names: LSM1; CASM; YJL124C
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LSM1; Monoclonal Antibody; LSM1 (U6 snRNA-associated Sm-like Protein LSm1; Cancer-associated Sm-like; Small Nuclear Ribonuclear CaSm; CASM) (FITC); anti-LSM1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F7
• Specificity: Recognizes human LSM1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-LSM1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa34-134 from human LSM1 (NP_055277) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged LSM1 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-LSM1 antibody

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Product Categories/Family for anti-LSM1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7657313
• NCBI GeneID: 27257
• NCBI Accession #: NP_055277
• NCBI GenBank Nucleotide #: NM_014462
• UniProt Accession #: O15116; B2R5E6
• Molecular Weight: 17.3kDa (153aa), confirmed by MALDI-TOF
• NCBI Official Full Name: U6 snRNA-associated Sm-like protein LSm1
• NCBI Official Synonym Full Names: LSM1 homolog, mRNA degradation associated
• NCBI Official Symbol: LSM1
• NCBI Official Synonym Symbols: CASM; YJL124C
• NCBI Protein Information: U6 snRNA-associated Sm-like protein LSm1
• UniProt Protein Name: U6 snRNA-associated Sm-like protein LSm1
• Protein Family: Sm-like protein
• UniProt Gene Name: LSM1
• UniProt Synonym Gene Names: CASM
• UniProt Entry Name: LSM1_HUMAN

NCBI Description

This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011]

Uniprot Description

LSM1: Plays a role in replication-dependent histone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA. Belongs to the snRNP Sm proteins family.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 8p11.2

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: protein binding; RNA cap binding

Biological Process: RNA splicing, via transesterification reactions; deadenylation-dependent decapping; RNA splicing; gene expression; mRNA processing; mRNA catabolic process, deadenylation-dependent decay