Mouse anti-Human LSD1 Monoclonal Antibody | anti-LSD1 antibody

LSD1 (Lysine-specific Histone Demethylase 1A, BRAF35-HDAC Complex Protein BHC110, Flavin-containing Amine Oxidase Domain-containing Protein 2, KDM1A, AOF2, KDM1, KIAA0601) (HRP)

Cat. Num. AAA6153365

• Gene Names: KDM1A; AOF2; CPRF; KDM1; LSD1; BHC110
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LSD1; Monoclonal Antibody; LSD1 (Lysine-specific Histone Demethylase 1A; BRAF35-HDAC Complex Protein BHC110; Flavin-containing Amine Oxidase Domain-containing Protein 2; KDM1A; AOF2; KDM1; KIAA0601) (HRP); anti-LSD1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E7
• Specificity: Recognizes human AOF2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 852

• Applicable Applications for anti-LSD1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa753-852 from AOF2 (NP_055828) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to AOF2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to AOF2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged AOF2 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-LSD1 antibody

Antibodies; Enzymes; Deacetylase

NCBI and Uniprot Product Information

• NCBI GI #: 58761546
• NCBI GeneID: 23028
• NCBI Accession #: NP_055828
• NCBI GenBank Nucleotide #: NM_015013
• UniProt Accession #: O60341
• NCBI Official Full Name: lysine-specific histone demethylase 1A isoform b
• NCBI Official Synonym Full Names: lysine demethylase 1A
• NCBI Official Symbol: KDM1A
• NCBI Official Synonym Symbols: AOF2; CPRF; KDM1; LSD1; BHC110
• NCBI Protein Information: lysine-specific histone demethylase 1A
• UniProt Protein Name: Lysine-specific histone demethylase 1A
• Protein Family: Lysine-specific histone demethylase
• UniProt Gene Name: KDM1A
• UniProt Synonym Gene Names: AOF2; KDM1; KIAA0601; LSD1
• UniProt Entry Name: KDM1A_HUMAN

NCBI Description

This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]