Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of LRRK1 transfected lysate using LRRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with LRRK1 rabbit polyclonal antibody.)

Mouse anti-Human LRRK1 Monoclonal Antibody | anti-LRRK1 antibody

LRRK1 (Leucine-rich Repeat Kinase 1, Leucine-rich Repeat Serine/threonine-protein Kinase 1, FLJ23119, FLJ27465, KIAA1790, RIPK6, Roco1) APC

Gene Names
LRRK1; RIPK6; Roco1
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LRRK1; Monoclonal Antibody; LRRK1 (Leucine-rich Repeat Kinase 1; Leucine-rich Repeat Serine/threonine-protein Kinase 1; FLJ23119; FLJ27465; KIAA1790; RIPK6; Roco1) APC; anti-LRRK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G8
Specificity
Recognizes human LRRK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
3509
Applicable Applications for anti-LRRK1 antibody
ELISA (EIA), Immunoprecipitation (IP), Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa560-659 from human LRRK1 (AAH05408) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIWVPRRGGDVIVIGLEKDSEAQRGRVIAVLKARELTPHGIMPVSSVKVCWAGWPVRDMVYMAAVM
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of LRRK1 transfected lysate using LRRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with LRRK1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of LRRK1 transfected lysate using LRRK1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with LRRK1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged LRRK1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LRRK1 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-LRRK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens leucine-rich repeat kinase 1, mRNA
NCBI Official Synonym Full Names
leucine rich repeat kinase 1
NCBI Official Symbol
LRRK1
NCBI Official Synonym Symbols
RIPK6; Roco1
NCBI Protein Information
leucine-rich repeat serine/threonine-protein kinase 1

NCBI Description

This gene encodes a multi-domain protein that is a leucine-rich repeat kinase and a GDP/GTP binding protein. The encoded protein is thought to play a role in the regulation of bone mass. Mice lacking a similar gene showed severe osteopetrosis, increased bone mineralization and decreased bone resorption. [provided by RefSeq, Jan 2017]

Research Articles on LRRK1

Similar Products

Product Notes

The LRRK1 (Catalog #AAA6137453) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LRRK1 (Leucine-rich Repeat Kinase 1, Leucine-rich Repeat Serine/threonine-protein Kinase 1, FLJ23119, FLJ27465, KIAA1790, RIPK6, Roco1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LRRK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LRRK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LRRK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.