Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human LOXL2 Monoclonal Antibody | anti-LOXL2 antibody

LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (Biotin)

Gene Names
LOXL2; LOR2; WS9-14
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LOXL2; Monoclonal Antibody; LOXL2 (Lysyl Oxidase-like Protein 2; Lysyl Oxidase Related Protein 2; LOR2; Lysyl Oxidase Homolog 2; Lysyl Oxidase Related Protein WS9-14) (Biotin); anti-LOXL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5D2
Specificity
Recognizes human LOXL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-LOXL2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa675-773 from human LOXL2 (NP_002309) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged LOXL2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LOXL2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-LOXL2 antibody
Lysyl Oxidase (LO) is an extracellular, copper-dependent enzyme that initiates the cross-linking of collagens and elastin by catalyzing the oxidative deamination of peptidyl lysine to alpha-aminoadipic-delta-semialdehyde. Members of LO family have diverse functions which include tumor suppression and cell adhesion and senescence. LOXL2, a 87kD protein, is a novel member of this family. It contains 3 potential N-linked glycosylation sites, 4 scavenger receptor cysteine-rich (SRCR) domains and highly conserved copper-binding and Lysyl-tyrosylquinone cofactor sites. It is a component of extracellular matrix that might be involved in cell adhesion and senescence. Role of LOXL2 has been implicated in malignant transformation.
Product Categories/Family for anti-LOXL2 antibody
References
1. Reduced nuclear and ectopic cytoplasmic expression of lysyl oxidase-like 2 is associated with lymph node metastasis and poor prognosis in esophageal squamous cell carcinoma. Li TY, Xu LY, Wu ZY, Liao LD, Shen JH, Xu XE, Du ZP, Zhao Q, Li EM.Hum Pathol. 2011 Dec 26. 2. Epithelial-Mesenchymal Transition Induced by Hepatitis C Virus Core Protein in Cholangiocarcinoma. Li T, Li D, Cheng L, Wu H, Gao Z, Liu Z, Jiang W, Gao YH, Tian F, Zhao L, Wang S.Ann Surg Oncol. 2010 Feb 17. 3. Reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes. Fujimoto E, Tajima S.J Dermatol Sci. 2009 Aug;55(2):91-8. Epub 2009 Apr 24.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,725 Da
NCBI Official Full Name
lysyl oxidase homolog 2
NCBI Official Synonym Full Names
lysyl oxidase-like 2
NCBI Official Symbol
LOXL2
NCBI Official Synonym Symbols
LOR2; WS9-14
NCBI Protein Information
lysyl oxidase homolog 2; lysyl oxidase related 2; lysyl oxidase-like 2 delta e13; lysyl oxidase-like 2 protein; lysyl oxidase-like protein 2; lysyl oxidase-related protein 2; lysyl oxidase-related protein WS9-14
UniProt Protein Name
Lysyl oxidase homolog 2
Protein Family
UniProt Gene Name
LOXL2
UniProt Entry Name
LOXL2_HUMAN

Uniprot Description

LOXL2: Mediates the post-translational oxidative deamination of lysine residues on target proteins leading to the formation of deaminated lysine (allysine). When secreted in extracellular matrix, promotes cross-linking of extracellular matrix proteins by mediating oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Acts as a regulator of sprouting angiogenesis, probably via collagen IV scaffolding. When nuclear, acts as a transcription corepressor and specifically mediates deamination of trimethylated 'Lys-4' of histone H3 (H3K4me3), a specific tag for epigenetic transcriptional activation. Involved in epithelial to mesenchymal transition (EMT) via interaction with SNAI1 and participates in repression of E- cadherin, probably by mediating deamination of histone H3. Also involved in E-cadherin repression following hypoxia, a hallmark of epithelial to mesenchymal transition believed to amplify tumor aggressiveness, suggesting that it may play a role in tumor progression. Acts as a regulator of chondrocyte differentiation, probably by regulating expression of factors that control chondrocyte differentiation. Belongs to the lysyl oxidase family.

Protein type: Secreted, signal peptide; Secreted; Cell adhesion; Oxidoreductase; EC 1.4.3.13

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: basement membrane; chromosome; extracellular space; membrane; nucleoplasm; nucleus

Molecular Function: chromatin binding; copper ion binding; electron carrier activity; methylated histone residue binding; protein binding; protein-lysine 6-oxidase activity; scavenger receptor activity; transcription corepressor activity

Biological Process: aging; cell adhesion; collagen fibril organization; endothelial cell migration; endothelial cell proliferation; epithelial to mesenchymal transition; histone modification; negative regulation of transcription, DNA-dependent; positive regulation of chondrocyte differentiation; protein amino acid deamination; protein modification process; receptor-mediated endocytosis; response to copper ion; response to hypoxia; sprouting angiogenesis; transcription, DNA-dependent

Similar Products

Product Notes

The LOXL2 loxl2 (Catalog #AAA6142741) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LOXL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LOXL2 loxl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LOXL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.