Mouse anti-Human LOX1 Monoclonal Antibody | anti-LOX1 antibody

LOX1 (Oxidized Low-density Lipoprotein Receptor 1, Ox-LDL Receptor 1, C-type Lectin Domain Family 8 Member A, Lectin-like Oxidized LDL Receptor 1, LOX-1, Lectin-like oxLDL Receptor 1, hLOX-1, Lectin-type Oxidized LDL Receptor 1, OLR1, CLEC8A) (HRP)

Cat. Num. AAA6153346

• Gene Names: OLR1; LOX1; LOXIN; SLOX1; CLEC8A; SCARE1
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LOX1; Monoclonal Antibody; LOX1 (Oxidized Low-density Lipoprotein Receptor 1; Ox-LDL Receptor 1; C-type Lectin Domain Family 8 Member A; Lectin-like Oxidized LDL Receptor 1; LOX-1; Lectin-like oxLDL Receptor 1; hLOX-1; Lectin-type Oxidized LDL Receptor 1; OLR1; CLEC8A) (HRP); anti-LOX1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C9
• Specificity: Recognizes human OLR1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-LOX1 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-274 from human OLR1 (AAH22295) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged OLR1 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-LOX1 antibody

OLR1, is a type II membrane protein that is a member of the C-type lectin family and acts as a cell-surface receptor for Ox-LDL. Ox-LDL plays a role in early ather-osclerosis, which includes the transformation of monocyte-derived macro-phages to foam cells in atherosclerotic lesions. This protein may also trigger the activation of the NFkB signal transduction pathway.

Product Categories/Family for anti-LOX1 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 18490152
• NCBI GeneID: 4973
• Molecular Weight: 21,425 Da
• NCBI Official Full Name: Homo sapiens oxidized low density lipoprotein (lectin-like) receptor 1, mRNA
• NCBI Official Synonym Full Names: oxidized low density lipoprotein receptor 1
• NCBI Official Symbol: OLR1
• NCBI Official Synonym Symbols: LOX1; LOXIN; SLOX1; CLEC8A; SCARE1
• NCBI Protein Information: oxidized low-density lipoprotein receptor 1

NCBI Description

This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]