Mouse anti-Human, Mouse LITAF Monoclonal Antibody | anti-LITAF antibody

LITAF (Lipopolysaccharide-induced Tumor Necrosis Factor-alpha factor, LPS-induced TNF-alpha Factor, Small Integral Membrane Protein of Lysosome/Late Endosome, p53-induced Gene 7 Protein, PIG7, SIMPLE) (MaxLight 650)

Cat. Num. AAA6222999

• Gene Names: LITAF; PIG7; SIMPLE; TP53I7
• Reactivity: Human, Mouse
• Applications: FLISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LITAF; Monoclonal Antibody; LITAF (Lipopolysaccharide-induced Tumor Necrosis Factor-alpha factor; LPS-induced TNF-alpha Factor; Small Integral Membrane Protein of Lysosome/Late Endosome; p53-induced Gene 7 Protein; PIG7; SIMPLE) (MaxLight 650); anti-LITAF antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E12
• Specificity: Recognizes human LITAF.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
• Sequence Length: 2642

• Applicable Applications for anti-LITAF antibody: FLISA
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-161 from LITAF (NP_004853) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
• Conjugate: MaxLight650
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-LITAF antibody

Lipopolysaccharide-induced tumor necrosis factor-alpha factor(LITAF) mediates the expression of inflammatory cytokines such as TNF-alpha in Lipopolysaccharide-induced processes. LITAF binds to STAT6B, a member of the STAT6 family forming a complex on the TNF-alpha promoter that modulates TNF activity. High levels of expression of LITAF mRNA have been observed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.

Product Categories/Family for anti-LITAF antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 210147490
• NCBI GeneID: 9516
• NCBI Accession #: NM_004862.3
• NCBI GenBank Nucleotide #: NM_004862
• UniProt Accession #: Q99732
• NCBI Official Full Name: Homo sapiens lipopolysaccharide induced TNF factor (LITAF), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: lipopolysaccharide induced TNF factor
• NCBI Official Symbol: LITAF
• NCBI Official Synonym Symbols: PIG7; SIMPLE; TP53I7
• NCBI Protein Information: lipopolysaccharide-induced tumor necrosis factor-alpha factor
• UniProt Protein Name: Lipopolysaccharide-induced tumor necrosis factor-alpha factor
• Protein Family: Lipopolysaccharide-induced tumor necrosis factor-alpha factor
• UniProt Gene Name: LITAF
• UniProt Synonym Gene Names: PIG7; SIMPLE; LPS-induced TNF-alpha factor
• UniProt Entry Name: LITAF_HUMAN

NCBI Description

Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

LITAF: Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF- alpha) gene expression. Interacts with NEDD4. Interacts with WWOX. Isoform 2 may interact with STAT6. By bacterial lipopolysaccharides (LPS) or p53/TP53. In monocytes by the Bacillus Calmette-Guerin (BCG). Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 16p13.13

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; lysosomal membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; signal transducer activity; WW domain binding

Biological Process: regulation of transcription from RNA polymerase II promoter; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; apoptosis; negative regulation of NF-kappaB import into nucleus; signal transduction; aging; regulation of cytokine production

Disease: Charcot-marie-tooth Disease, Demyelinating, Type 1c