Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LITAF expression in transfected 293T cell line by LITAF polyclonal antibody. Lane 1: LITAF transfected lysate (17.1kD). Lane 2: Non-transfected lysate. )

Rabbit anti-Human LITAF Polyclonal Antibody | anti-LITAF antibody

LITAF (Lipopolysaccharide-induced Tumor Necrosis Factor-alpha factor, LPS-induced TNF-alpha Factor, Small Integral Membrane Protein of Lysosome/Late Endosome, p53-induced Gene 7 Protein, PIG7, SIMPLE) (HRP)

Gene Names
LITAF; PIG7; SIMPLE; TP53I7
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LITAF; Polyclonal Antibody; LITAF (Lipopolysaccharide-induced Tumor Necrosis Factor-alpha factor; LPS-induced TNF-alpha Factor; Small Integral Membrane Protein of Lysosome/Late Endosome; p53-induced Gene 7 Protein; PIG7; SIMPLE) (HRP); anti-LITAF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LITAF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
2368
Applicable Applications for anti-LITAF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LITAF, aa1-161 (NP_004853.2).
Immunogen Sequence
MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LITAF expression in transfected 293T cell line by LITAF polyclonal antibody. Lane 1: LITAF transfected lysate (17.1kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of LITAF expression in transfected 293T cell line by LITAF polyclonal antibody. Lane 1: LITAF transfected lysate (17.1kD). Lane 2: Non-transfected lysate. )
Related Product Information for anti-LITAF antibody
Lipopolysaccharide-induced tumor necrosis factor-alpha factor(LITAF) mediates the expression of inflammatory cytokines such as TNF-alpha in Lipopolysaccharide-induced processes. LITAF binds to STAT6B, a member of the STAT6 family forming a complex on the TNF-alpha promoter that modulates TNF activity. High levels of expression of LITAF mRNA have been observed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.
Product Categories/Family for anti-LITAF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens lipopolysaccharide-induced TNF factor (LITAF), mRNA
NCBI Official Synonym Full Names
lipopolysaccharide induced TNF factor
NCBI Official Symbol
LITAF
NCBI Official Synonym Symbols
PIG7; SIMPLE; TP53I7
NCBI Protein Information
lipopolysaccharide-induced tumor necrosis factor-alpha factor

NCBI Description

Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2014]

Research Articles on LITAF

Similar Products

Product Notes

The LITAF (Catalog #AAA6384294) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LITAF (Lipopolysaccharide-induced Tumor Necrosis Factor-alpha factor, LPS-induced TNF-alpha Factor, Small Integral Membrane Protein of Lysosome/Late Endosome, p53-induced Gene 7 Protein, PIG7, SIMPLE) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LITAF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LITAF for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LITAF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.