Western Blot (WB)
(Western Blot detection against Immunogen (35.9kD).)
Mouse anti-Human LHX3 Monoclonal Antibody | anti-LHX3 antibody
LHX3 (LIM/Homeobox Protein Lhx3, LIM Homeobox Protein 3, DKFZp762A2013) (HRP)
Gene Names
LHX3; LIM3; CPHD3; M2-LHX3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LHX3; Monoclonal Antibody; LHX3 (LIM/Homeobox Protein Lhx3; LIM Homeobox Protein 3; DKFZp762A2013) (HRP); anti-LHX3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C10
Specificity
Recognizes human LHX3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-LHX3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa228-317 from LHX3 (NP_055379) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRP*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.9kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.9kD).)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to LHX3 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to LHX3 on HeLa cell. [antibody concentration 10ug/ml])
Related Product Information for anti-LHX3 antibody
Acts as a transcriptional activator. Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with Pit-1.
Product Categories/Family for anti-LHX3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44kDa
NCBI Official Full Name
LIM/homeobox protein Lhx3 isoform b
NCBI Official Synonym Full Names
LIM homeobox 3
NCBI Official Symbol
LHX3
NCBI Official Synonym Symbols
LIM3; CPHD3; M2-LHX3
NCBI Protein Information
LIM/homeobox protein Lhx3
Protein Family
NCBI Description
This gene encodes a member of a large family of proteins which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene cause combined pituitary hormone deficiency 3. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
Research Articles on LHX3
Similar Products
Product Notes
The LHX3 (Catalog #AAA6153307) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LHX3 (LIM/Homeobox Protein Lhx3, LIM Homeobox Protein 3, DKFZp762A2013) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LHX3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LHX3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LHX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
