Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human LGR7 Monoclonal Antibody | anti-LGR7 antibody

LGR7 (Relaxin Receptor 1, Leucine-rich Repeat-containing G-protein Coupled Receptor 7, Relaxin Family Peptide Receptor 1, RXFP1, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177) (MaxLight 490)

Gene Names
RXFP1; LGR7; RXFPR1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LGR7; Monoclonal Antibody; LGR7 (Relaxin Receptor 1; Leucine-rich Repeat-containing G-protein Coupled Receptor 7; Relaxin Family Peptide Receptor 1; RXFP1; LGR7.1; LGR7.10; LGR7.2; MGC138347; MGC142177) (MaxLight 490); anti-LGR7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E3
Specificity
Recognizes human LGR7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
757
Applicable Applications for anti-LGR7 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa68-163 from human LGR7 (NP_067647) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKI
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-LGR7 antibody
LGR7 is a member of the Relaxin Receptor subfamily. LGR7 has been reported in adrenal, brain, colon, heart, kidney, liver, lung, ovary, placenta, prostate, salivary gland, small intestine, testis, and uterus. ESTs have been isolated from melanocyte/uterus/fetal heart and skeletal muscle libraries.
Product Categories/Family for anti-LGR7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
relaxin receptor 1 isoform 1
NCBI Official Synonym Full Names
relaxin family peptide receptor 1
NCBI Official Symbol
RXFP1
NCBI Official Synonym Symbols
LGR7; RXFPR1
NCBI Protein Information
relaxin receptor 1
UniProt Protein Name
Relaxin receptor 1
UniProt Gene Name
RXFP1
UniProt Synonym Gene Names
LGR7
UniProt Entry Name
RXFP1_HUMAN

NCBI Description

This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane receptor superfamily. The encoded protein plays a critical role in sperm motility, pregnancy and parturition as a receptor for the protein hormone relaxin. Decreased expression of this gene may play a role in endometriosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

RXFP1: Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP. Belongs to the G-protein coupled receptor 1 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q32.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; protein binding; metal ion binding

Biological Process: G-protein coupled receptor protein signaling pathway

Research Articles on LGR7

Similar Products

Product Notes

The LGR7 rxfp1 (Catalog #AAA6201630) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LGR7 (Relaxin Receptor 1, Leucine-rich Repeat-containing G-protein Coupled Receptor 7, Relaxin Family Peptide Receptor 1, RXFP1, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LGR7 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LGR7 rxfp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LGR7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.