Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LFNG monoclonal antibody (M11), clone 1B6. Western Blot analysis of LFNG expression in human pancreas.)

Mouse LFNG Monoclonal Antibody | anti-LFNG antibody

LFNG (LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, SCDO3) (PE)

Gene Names
LFNG; SCDO3
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
LFNG; Monoclonal Antibody; LFNG (LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; SCDO3) (PE); LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; SCDO3; anti-LFNG antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B6
Specificity
Recognizes LFNG.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
250
Applicable Applications for anti-LFNG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LFNG (NP_002295, 1aa-125aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVVITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPIQAMERVSENKVRPVHFWFAT*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(LFNG monoclonal antibody (M11), clone 1B6. Western Blot analysis of LFNG expression in human pancreas.)

Western Blot (WB) (LFNG monoclonal antibody (M11), clone 1B6. Western Blot analysis of LFNG expression in human pancreas.)
Related Product Information for anti-LFNG antibody
This gene encodes a member of the glycosyltransferase superfamily. The encoded protein is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Alternatively spliced transcript variants that encode different isoforms have been described, however, not all variants have been fully characterized. [provided by RefSeq]
Product Categories/Family for anti-LFNG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
beta-1,3-N-acetylglucosaminyltransferase lunatic fringe isoform d
NCBI Official Synonym Full Names
LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
NCBI Official Symbol
LFNG
NCBI Official Synonym Symbols
SCDO3
NCBI Protein Information
beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
UniProt Protein Name
Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
UniProt Gene Name
LFNG
UniProt Entry Name
LFNG_HUMAN

NCBI Description

This gene is a member of the glycosyltransferase 31 gene family. Members of this gene family, which also includes the MFNG (GeneID: 4242) and RFNG (GeneID: 5986) genes, encode evolutionarily conserved glycosyltransferases that act in the Notch signaling pathway to define boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, these proteins have a fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. The protein encoded by this gene is predicted to be a single-pass type II Golgi membrane protein but it may also be secreted and proteolytically processed like the related proteins in mouse and Drosophila (PMID: 9187150). Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. [provided by RefSeq, May 2018]

Uniprot Description

LFNG: Glycosyltransferase that initiates the elongation of O- linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. Decreases the binding of JAGGED1 to NOTCH2 but not that of DELTA1. Essential mediator of somite segmentation and patterning. Defects in LFNG are the cause of spondylocostal dysostosis type 3 (SCDO3). An autosomal recessive condition of variable severity associated with vertebral and rib segmentation defects. The main skeletal malformations include fusion of vertebrae, hemivertebrae, fusion of certain ribs, and other rib malformations. Deformity of the chest and spine (severe scoliosis, kyphoscoliosis and lordosis) is a natural consequence of the malformation and leads to a dwarf-like appearance. As the thorax is small, infants frequently have respiratory insufficiency and repeated respiratory infections resulting in life-threatening complications in the first year of life. Belongs to the glycosyltransferase 31 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transferase; Cell cycle regulation; EC 2.4.1.222

Chromosomal Location of Human Ortholog: 7p22.2

Cellular Component: extracellular region; integral to Golgi membrane; vesicle

Molecular Function: metal ion binding; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase activity

Biological Process: compartment specification; organ morphogenesis; somitogenesis; Notch signaling pathway; positive regulation of protein binding; ovarian follicle development; regulation of Notch signaling pathway; metabolic process; female meiosis; regulation of somitogenesis; positive regulation of Notch signaling pathway

Disease: Spondylocostal Dysostosis 3, Autosomal Recessive

Research Articles on LFNG

Similar Products

Product Notes

The LFNG lfng (Catalog #AAA6186679) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LFNG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LFNG lfng for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LFNG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.