Mouse anti-Human LETM1 and EF-hand Domain Containing Protein 1 Monoclonal Antibody | anti-LETM1 antibody

LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial (LETM1, Leucine Zipper-EF-hand-containing Transmembrane Protein 1) (PE)

Cat. Num. AAA6158603

• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LETM1 and EF-hand Domain Containing Protein 1; Monoclonal Antibody; Mitochondrial (LETM1; Leucine Zipper-EF-hand-containing Transmembrane Protein 1) (PE); anti-LETM1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6F7
• Specificity: Recognizes human LETM1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-LETM1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa601-708 from human LETM1 (NP_036450) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LETM1 expression in transfected 293T cell line by LETM1 monoclonal antibody. Lane 1: LETM1 transfected lysate (83.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LETM1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LETM1 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of LETM1 transfected lysate using LETM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with LETM1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged LETM1 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(LETM1 monoclonal antibody Western Blot analysis of LETM1 expression in HeLa.)

Product Categories/Family for anti-LETM1 antibody

Antibodies; Cell Markers

NCBI and Uniprot Product Information

• NCBI GI #: 6912482
• NCBI GeneID: 3954
• NCBI Accession #: NP_036450
• NCBI GenBank Nucleotide #: NM_012318
• UniProt Accession #: O95202; Q9UF65; B4DED2
• Molecular Weight: 33,245 Da
• NCBI Official Full Name: LETM1 and EF-hand domain-containing protein 1, mitochondrial
• NCBI Official Synonym Full Names: leucine zipper-EF-hand containing transmembrane protein 1
• NCBI Official Symbol: LETM1
• NCBI Protein Information: LETM1 and EF-hand domain-containing protein 1, mitochondrial; Mdm38 homolog
• UniProt Protein Name: LETM1 and EF-hand domain-containing protein 1, mitochondrial
• Protein Family: LETM1 and EF-hand domain-containing protein
• UniProt Gene Name: LETM1
• UniProt Entry Name: LETM1_HUMAN