Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LEFTY1 monoclonal antibody Western Blot analysis of LEFTY1 expression in C32.)

Mouse anti-Human LEFTY1 Monoclonal Antibody | anti-LEFTY1 antibody

LEFTY1 (Left-right Determination Factor 1, Left-right Determination Factor B, Protein Lefty-1, Protein Lefty-B, LEFTB, LEFTYB, UNQ278/PRO317)

Gene Names
LEFTY1; LEFTB; LEFTYB
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LEFTY1; Monoclonal Antibody; LEFTY1 (Left-right Determination Factor 1; Left-right Determination Factor B; Protein Lefty-1; Protein Lefty-B; LEFTB; LEFTYB; UNQ278/PRO317); Anti -LEFTY1 (Left-right Determination Factor 1; anti-LEFTY1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E10
Specificity
Recognizes human LEFTY1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQPLWLCWALWVLPLASPGAALAGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSLRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Applicable Applications for anti-LEFTY1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-366 from LEFTY1 (AAH27883) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(LEFTY1 monoclonal antibody Western Blot analysis of LEFTY1 expression in C32.)

Western Blot (WB) (LEFTY1 monoclonal antibody Western Blot analysis of LEFTY1 expression in C32.)

Western Blot (WB)

(LEFTY1 monoclonal antibody Western Blot analysis of LEFTY1 expression in THP-1.)

Western Blot (WB) (LEFTY1 monoclonal antibody Western Blot analysis of LEFTY1 expression in THP-1.)
Related Product Information for anti-LEFTY1 antibody
LEFTB is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. Alternative processing of this protein can yield three different products.
Product Categories/Family for anti-LEFTY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,880 Da
NCBI Official Full Name
left-right determination factor 1 preproprotein
NCBI Official Synonym Full Names
left-right determination factor 1
NCBI Official Symbol
LEFTY1
NCBI Official Synonym Symbols
LEFTB; LEFTYB
NCBI Protein Information
left-right determination factor 1; protein lefty-1; protein lefty-B; left-right determination factor B; left-right determination, factor B
UniProt Protein Name
Left-right determination factor 1
UniProt Gene Name
LEFTY1
UniProt Synonym Gene Names
LEFTB; LEFTYB
UniProt Entry Name
LFTY1_HUMAN

NCBI Description

This gene encodes a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene. [provided by RefSeq, Jul 2008]

Uniprot Description

LEFTY1: Required for left-right axis determination as a regulator of LEFTY2 and NODAL. Belongs to the TGF-beta family.

Protein type: Cytokine; Secreted; Motility/polarity/chemotaxis; Ligand, receptor tyrosine kinase; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q42.1

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: regulation of apoptosis; heart morphogenesis; regulation of MAPKKK cascade; transforming growth factor beta receptor signaling pathway; negative regulation of transcription from RNA polymerase II promoter; determination of left/right symmetry; cell growth; cell development

Research Articles on LEFTY1

Similar Products

Product Notes

The LEFTY1 lefty1 (Catalog #AAA6004270) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LEFTY1 (Left-right Determination Factor 1, Left-right Determination Factor B, Protein Lefty-1, Protein Lefty-B, LEFTB, LEFTYB, UNQ278/PRO317) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LEFTY1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the LEFTY1 lefty1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQPLWLCWAL WVLPLASPGA ALAGEQLLGS LLRQLQLKEV PTLDRADMEE LVIPTHVRAQ YVALLQRSHG DRSRGKRFSQ SFREVAGRFL ALEASTHLLV FGMEQRLPPN SELVQAVLRL FQEPVPKAAL HRHGRLSLRS ARARVTVEWL RVRDDGSNRT SLIDSRLVSV HESGWKAFDV TEAVNFWQQL SRPRQPLLLQ VSVQREHLGP LASGAHKLVR FASQGAPAGL GEPQLELHTL DLGDYGAQGD CDPEAPMTEG TRCCRQEMYI DLQGMKWAEN WVLEPPGFLA YECVGTCRQP PEALAFKWPF LGPRQCIASE TDSLPMIVSI KEGGRTRPQV VSLPNMRVQK CSCASDGALV PRRLQP. It is sometimes possible for the material contained within the vial of "LEFTY1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.