Mouse anti-Human LEF1 Monoclonal Antibody | anti-LEF1 antibody

LEF1 (Lymphoid Enhancer-binding Factor 1, T Cell-specific Transcription Factor 1-alpha, DKFZp586H0919) (PE)

Cat. Num. AAA6158597

• Gene Names: LEF1; LEF-1; TCF10; TCF7L3; TCF1ALPHA
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LEF1; Monoclonal Antibody; LEF1 (Lymphoid Enhancer-binding Factor 1; T Cell-specific Transcription Factor 1-alpha; DKFZp586H0919) (PE); anti-LEF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3H5
• Specificity: Recognizes human LEF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-LEF1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-400 from human LEF1 (AAH50632) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(LEF1 monoclonal antibody. Western Blot analysis of LEF1 expression in HL-60.)

Western Blot (WB)

(LEF1 monoclonal antibody, Western Blot analysis of LEF1 expression in MES-SA/Dx5.)

Western Blot (WB)

(Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody. Lane 1: LEF1 transfected lysate (44.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged LEF1 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(Western Blot detection against Immunogen (70kD).)

Related Product Information for anti-LEF1 antibody

This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants.

Product Categories/Family for anti-LEF1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 34193554
• NCBI GeneID: 51176
• Molecular Weight: 34,103 Da
• NCBI Official Full Name: Homo sapiens lymphoid enhancer-binding factor 1, mRNA
• NCBI Official Synonym Full Names: lymphoid enhancer binding factor 1
• NCBI Official Symbol: LEF1
• NCBI Official Synonym Symbols: LEF-1; TCF10; TCF7L3; TCF1ALPHA
• NCBI Protein Information: lymphoid enhancer-binding factor 1
• Protein Family: Lymphoid enhancer-binding factor

NCBI Description

This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereby conferring maximal enhancer activity. This transcription factor is involved in the Wnt signaling pathway, and it may function in hair cell differentiation and follicle morphogenesis. Mutations in this gene have been found in somatic sebaceous tumors. This gene has also been linked to other cancers, including androgen-independent prostate cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]