Mouse anti-Human LAMA5 Monoclonal Antibody | anti-LAMA5 antibody

LAMA5 (Laminin Subunit alpha-5, Laminin-10 Subunit alpha, Laminin-11 Subunit alpha, Laminin-15 Subunit alpha, KIAA0533, KIAA1907) (HRP)

Cat. Num. AAA6153267

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LAMA5; Monoclonal Antibody; LAMA5 (Laminin Subunit alpha-5; Laminin-10 Subunit alpha; Laminin-11 Subunit alpha; Laminin-15 Subunit alpha; KIAA0533; KIAA1907) (HRP); anti-LAMA5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F7
• Specificity: Recognizes human LAMA5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 3173

• Applicable Applications for anti-LAMA5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human LAMA5 (AAH03355.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of LAMA5 expression in transfected 293T cell line by LAMA5 monoclonal antibody. Lane 1: LAMA5 transfected lysate (74kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged LAMA5 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-LAMA5 antibody

Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.

Product Categories/Family for anti-LAMA5 antibody

Antibodies; Lamin; Laminin

References

1. Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion. Little GH, Noushmehr H, Baniwal SK, Berman BP, Coetzee GA, Frenkel B.Nucleic Acids Res. 2011 Dec 19. 2. Melanoma cells produce multiple laminin isoforms and strongly migrate on ?5 laminin(s) via several integrin receptors. Oikawa Y, Hansson J, Sasaki T, Rousselle P, Domogatskaya A, Rodin S, Tryggvason K, Patarroyo M.Exp Cell Res. 2010 Dec 31. 3. Proteomics Analysis of Nasopharyngeal Carcinoma Cell Secretome Using a Hollow Fiber Culture System and Mass Spectrometry. Wu HY, Chang YH, Chang YC, Liao PC.J Proteome Res. 2009 Jan;8(1):380-9. 4. Proteomic analysis of platelet a-granules using mass spectrometry. Maynard DM, Heijnen HF, Horne MK, White JG, Gahl WA.J Thromb Haemost. 2007 Sep;5(9):1945-55.

NCBI and Uniprot Product Information

• NCBI GI #: 13097167
• NCBI GeneID: 3911
• NCBI Official Full Name: Homo sapiens laminin, alpha 5, mRNA
• NCBI Official Synonym Full Names: laminin subunit alpha 5
• NCBI Official Symbol: LAMA5
• NCBI Protein Information: laminin subunit alpha-5
• Protein Family: Laminin

NCBI Description

This gene encodes one of the vertebrate laminin alpha chains. Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. The protein encoded by this gene is the alpha-5 subunit of of laminin-10 (laminin-511), laminin-11 (laminin-521) and laminin-15 (laminin-523). [provided by RefSeq, Jun 2013]