Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human KRTAP13-1 Monoclonal Antibody | anti-KRTAP13-1 antibody

KRTAP13-1 (Keratin-associated Protein 13-1, High Sulfur Keratin-associated Protein 13.1, KAP13.1, KRTAP13.1)

Gene Names
KRTAP13-1; KAP13.1; KRTAP13.1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KRTAP13-1; Monoclonal Antibody; KRTAP13-1 (Keratin-associated Protein 13-1; High Sulfur Keratin-associated Protein 13.1; KAP13.1; KRTAP13.1); Anti -KRTAP13-1 (Keratin-associated Protein 13-1; anti-KRTAP13-1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2A1
Specificity
Recognizes human KRTAP13-1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
WHANSESSQCNSAELTSPINMSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSPCQTS
Applicable Applications for anti-KRTAP13-1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant protein corresponding to aa2-101 from human KRTAP13-1 (NP_853630) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)
Related Product Information for anti-KRTAP13-1 antibody
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Product Categories/Family for anti-KRTAP13-1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,320 Da
NCBI Official Full Name
keratin-associated protein 13-1
NCBI Official Synonym Full Names
keratin associated protein 13-1
NCBI Official Symbol
KRTAP13-1
NCBI Official Synonym Symbols
KAP13.1; KRTAP13.1
NCBI Protein Information
keratin-associated protein 13-1; high sulfur keratin associated protein 13.1; high sulfur keratin-associated protein 13.1
UniProt Protein Name
Keratin-associated protein 13-1
UniProt Gene Name
KRTAP13-1
UniProt Synonym Gene Names
KAP13.1; KRTAP13.1
UniProt Entry Name
KR131_HUMAN

NCBI Description

Hair keratins and hair keratin-associated proteins (KAPs), such as KRTAP13-1, are the main structural proteins of hair fibers (Rogers et al., 2002 [PubMed 12359730]).[supplied by OMIM, Mar 2008]

Uniprot Description

KRTAP13-1: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high- sulfur and high-glycine-tyrosine keratins. Belongs to the PMG family.

Chromosomal Location of Human Ortholog: 21q22.1

Cellular Component: intermediate filament

Similar Products

Product Notes

The KRTAP13-1 krtap13-1 (Catalog #AAA6010677) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KRTAP13-1 (Keratin-associated Protein 13-1, High Sulfur Keratin-associated Protein 13.1, KAP13.1, KRTAP13.1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KRTAP13-1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the KRTAP13-1 krtap13-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WHANSESSQC NSAELTSPIN MSYNCCSGNF SSRSCGGYLH YPASSCGFSY PSNQVYSTDL CSPSTCQLGS SLYRGCQQTC WEPTSCQTSY VESSPCQTS. It is sometimes possible for the material contained within the vial of "KRTAP13-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.