Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Mouse anti-Human KRT8 Monoclonal Antibody | anti-KRT8 antibody

KRT8 (Keratin, Type II Cytoskeletal 8, Cytokeratin-8, CK-8, Keratin-8, K8, CYK8, Type-II Keratin Kb8) (FITC)

Gene Names
KRT8; K8; KO; CK8; CK-8; CYK8; K2C8; CARD2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KRT8; Monoclonal Antibody; KRT8 (Keratin; Type II Cytoskeletal 8; Cytokeratin-8; CK-8; Keratin-8; K8; CYK8; Type-II Keratin Kb8) (FITC); anti-KRT8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E3
Specificity
Recognizes human KRT8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-KRT8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa91-195 from human KRT8 (NP_002264) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB)

(Western Blot analysis of KRT8 expression in transfected 293T cell line by KRT8 monoclonal antibody. Lane 1: KRT8 transfected lysate (53.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KRT8 expression in transfected 293T cell line by KRT8 monoclonal antibody. Lane 1: KRT8 transfected lysate (53.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KRT8 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KRT8 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-KRT8 antibody
KRT8 typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation.
Product Categories/Family for anti-KRT8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,608 Da
NCBI Official Full Name
keratin, type II cytoskeletal 8 isoform 2
NCBI Official Synonym Full Names
keratin 8
NCBI Official Symbol
KRT8
NCBI Official Synonym Symbols
K8; KO; CK8; CK-8; CYK8; K2C8; CARD2
NCBI Protein Information
keratin, type II cytoskeletal 8
UniProt Protein Name
Keratin, type II cytoskeletal 8
Protein Family
UniProt Gene Name
KRT8
UniProt Synonym Gene Names
CYK8; CK-8; K8
UniProt Entry Name
K2C8_HUMAN

NCBI Description

This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

K8: a type II cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Phosphorylation of keratins at specific sites affects their organization, assembly dynamics, and their interaction with signaling molecules. Phsophorylated by p38 kinase, regulating cellular keratin filament reorganization. Phosphorylation on serine residues is enhanced during EGF stimulation and mitosis. Mutation of this protein is a risk factor for cryptogenic liver failure.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: nucleoplasm; dystrophin-associated glycoprotein complex; intermediate filament cytoskeleton; costamere; nuclear matrix; keratin filament; cytoplasm; intermediate filament; intercellular junction; Z disc; nucleus; sarcolemma

Molecular Function: protein binding; protein complex binding; structural molecule activity

Biological Process: tumor necrosis factor-mediated signaling pathway; viral reproduction; sarcomere organization; response to other organism; response to hydrostatic pressure

Disease: Cirrhosis, Familial

Research Articles on KRT8

Similar Products

Product Notes

The KRT8 krt8 (Catalog #AAA6147953) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KRT8 (Keratin, Type II Cytoskeletal 8, Cytokeratin-8, CK-8, Keratin-8, K8, CYK8, Type-II Keratin Kb8) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KRT8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KRT8 krt8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KRT8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.