Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.51kD).)

Mouse anti-Human KRT4 Monoclonal Antibody | anti-KRT4 antibody

KRT4 (Keratin, Type II Cytoskeletal 4, Cytokeratin-4, CK-4, Keratin-4, K4, CYK4, Type-II Keratin Kb4, FLJ31692) (Biotin)

Gene Names
KRT4; K4; CK4; CK-4; CYK4; WSN1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KRT4; Monoclonal Antibody; KRT4 (Keratin; Type II Cytoskeletal 4; Cytokeratin-4; CK-4; Keratin-4; K4; CYK4; Type-II Keratin Kb4; FLJ31692) (Biotin); anti-KRT4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5H5
Specificity
Recognizes human KRT4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-KRT4 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa194-300 from human KRT4 (NP_002263) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.51kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.51kD).)

Western Blot (WB)

(KRT4 monoclonal antibody Western Blot analysis of KRT4 expression in A-431.)

Western Blot (WB) (KRT4 monoclonal antibody Western Blot analysis of KRT4 expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to KRT4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to KRT4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KRT4 on A-431 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to KRT4 on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged KRT4 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KRT4 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-KRT4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,285 Da
NCBI Official Full Name
keratin, type II cytoskeletal 4
NCBI Official Synonym Full Names
keratin 4, type II
NCBI Official Symbol
KRT4
NCBI Official Synonym Symbols
K4; CK4; CK-4; CYK4; WSN1
NCBI Protein Information
keratin, type II cytoskeletal 4; cytokeratin 4; type-II keratin Kb4
UniProt Protein Name
Keratin, type II cytoskeletal 4
Protein Family
UniProt Gene Name
KRT4
UniProt Synonym Gene Names
CYK4; CK-4; K4
UniProt Entry Name
K2C4_HUMAN

Uniprot Description

K4: Heterotetramer of two type I and two type II keratins. Keratin-4 is generally associated with keratin-13. Detected in the suprabasal layer of the stratified epithelium of the esophagus, exocervix, vagina, mouth and lingual mucosa, and in cells and cell clusters in the mucosa and serous gland ducts of the esophageal submucosa. Expressed widely in the exocervix and esophageal epithelium, with lowest levels detected in the basal cell layer. Belongs to the intermediate filament family.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: intermediate filament cytoskeleton; cell surface; keratin filament; intermediate filament; nucleus

Molecular Function: protein binding; structural molecule activity

Biological Process: epithelial cell differentiation; cytoskeleton organization and biogenesis; negative regulation of epithelial cell proliferation

Disease: White Sponge Nevus 1

Similar Products

Product Notes

The KRT4 krt4 (Catalog #AAA6142647) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KRT4 (Keratin, Type II Cytoskeletal 4, Cytokeratin-4, CK-4, Keratin-4, K4, CYK4, Type-II Keratin Kb4, FLJ31692) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KRT4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KRT4 krt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KRT4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.