Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse KPNB3 Monoclonal Antibody | anti-KPNB3 antibody

KPNB3 (Importin 5, Importin-5, Imp5, Importin Subunit beta-3, Karyopherin beta-3, Ran-binding Protein 5, RanBP5, IPO5, RANBP5) (MaxLight 405)

Gene Names
IPO5; IMB3; Pse1; imp5; KPNB3; RANBP5
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KPNB3; Monoclonal Antibody; KPNB3 (Importin 5; Importin-5; Imp5; Importin Subunit beta-3; Karyopherin beta-3; Ran-binding Protein 5; RanBP5; IPO5; RANBP5) (MaxLight 405); anti-KPNB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C4
Specificity
Recognizes human RANBP5. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-KPNB3 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human RANBP5 (AAH01497) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-KPNB3 antibody
References
1. Localization of retinitis pigmentosa 2 to cilia is regulated by Importin {beta}2. Hurd TW, Fan S, Margolis BL.J Cell Sci. 2011 Mar 1;124(Pt 5):718-26. Epub 2011 Feb 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
125,545 Da
NCBI Official Full Name
Homo sapiens importin 5, mRNA
NCBI Official Synonym Full Names
importin 5
NCBI Official Symbol
IPO5
NCBI Official Synonym Symbols
IMB3; Pse1; imp5; KPNB3; RANBP5
NCBI Protein Information
importin-5

NCBI Description

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. [provided by RefSeq, Jul 2008]

Research Articles on KPNB3

Similar Products

Product Notes

The KPNB3 (Catalog #AAA6190895) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KPNB3 (Importin 5, Importin-5, Imp5, Importin Subunit beta-3, Karyopherin beta-3, Ran-binding Protein 5, RanBP5, IPO5, RANBP5) (MaxLight 405) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KPNB3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KPNB3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KPNB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.