Mouse anti-Human KLF6 Monoclonal Antibody | anti-KLF6 antibody

KLF6 (Krueppel-like Factor 6, B Cell-derived Protein 1, BCD1, CBA1, Core Promoter Element Binding Protein, COPEB, CPBP, DKFZp686N0199, GBF, GC-rich Sites-binding Factor GBF, PAC1, Proto-oncogene BCD1, Suppressor of Tumorigenicity 12 Protein, ST12, Transcr

Cat. Num. AAA6147918

• Gene Names: KLF6; GBF; ZF9; BCD1; CBA1; CPBP; PAC1; ST12; COPEB
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KLF6; Monoclonal Antibody; KLF6 (Krueppel-like Factor 6; B Cell-derived Protein 1; BCD1; CBA1; Core Promoter Element Binding Protein; COPEB; CPBP; DKFZp686N0199; GBF; GC-rich Sites-binding Factor GBF; PAC1; Proto-oncogene BCD1; Suppressor of Tumorigenicity 12 Protein; ST12; Transcr; anti-KLF6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A9
• Specificity: Recognizes human KLF6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1545

• Applicable Applications for anti-KLF6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-260 from human KLF6 (AAH04301.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLGSSVTSAPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPF
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (54.34kD).)

Western Blot (WB)

(Western Blot analysis of KLF6 expression in transfected 293T cell line by KLF6 monoclonal antibody. Lane 1: KLF6 transfected lysate (31.865kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-KLF6 antibody

COPEB is a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor.

Product Categories/Family for anti-KLF6 antibody

Antibodies; Transcription Factors

References

1. Caffeic Acid Phenethyl Ester Causes p21 Induction, Akt Signaling Reduction, and Growth Inhibition in PC-3 Human Prostate Cancer Cells. Lin HP, Jiang SS, Chuu CP.PLoS One. 2012;7(2):e31286. Epub 2012 Feb 7.

NCBI and Uniprot Product Information

• NCBI GI #: 13279169
• NCBI GeneID: 1316
• NCBI Official Full Name: Homo sapiens Kruppel-like factor 6, mRNA
• NCBI Official Synonym Full Names: Kruppel like factor 6
• NCBI Official Symbol: KLF6
• NCBI Official Synonym Symbols: GBF; ZF9; BCD1; CBA1; CPBP; PAC1; ST12; COPEB
• NCBI Protein Information: Krueppel-like factor 6
• Protein Family: Krueppel-like factor

NCBI Description

This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. [provided by RefSeq, May 2009]