Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human KLF5 Monoclonal Antibody | anti-KLF5 antibody

KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (MaxLight 650

Gene Names
KLF5; CKLF; IKLF; BTEB2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLF5; Monoclonal Antibody; KLF5 (Kruppel-like Factor 5; Basic Transcription Element Binding Protein 2; BTE-binding Protein 2; BTEB2; Colon Krueppel-like Factor; CKLF; GC Box Binding Protein 2; Intestinal-enriched Krueppel-like Factor; IKLF; Transcription Factor BTEB2) (MaxLight 650; anti-KLF5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G12
Specificity
Recognizes human KLF5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-KLF5 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa358-457 from human KLF5 (NP_001721) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-KLF5 antibody
KLF5 is a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, the protein is thought to be a transcription factor.
Product Categories/Family for anti-KLF5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
688
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,116 Da
NCBI Official Full Name
Krueppel-like factor 5 isoform 1
NCBI Official Synonym Full Names
Kruppel-like factor 5 (intestinal)
NCBI Official Symbol
KLF5
NCBI Official Synonym Symbols
CKLF; IKLF; BTEB2
NCBI Protein Information
Krueppel-like factor 5; BTE-binding protein 2; GC box binding protein 2; Klf5C isoform; basic transcription element binding protein 2; colon krueppel-like factor; colon kruppel-like factor; intestinal-enriched krueppel-like factor; intestinal-enriched kru
UniProt Protein Name
Krueppel-like factor 5
Protein Family
UniProt Gene Name
KLF5
UniProt Synonym Gene Names
BTEB2; CKLF; IKLF; BTE-binding protein 2
UniProt Entry Name
KLF5_HUMAN

Uniprot Description

KLF5: Transcription factor that binds to GC box promoter elements. Activates the transcription of these genes. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 13q22.1

Cellular Component: nucleoplasm; Golgi apparatus; intracellular membrane-bound organelle; cytoplasm; plasma membrane

Molecular Function: protein binding; metal ion binding

Biological Process: transcription from RNA polymerase II promoter; microvillus biogenesis; positive regulation of cell proliferation; positive regulation of fat cell differentiation; positive regulation of transcription from RNA polymerase II promoter; angiogenesis; negative regulation of transcription from RNA polymerase II promoter; regulation of microvillus biogenesis

Similar Products

Product Notes

The KLF5 klf5 (Catalog #AAA6222896) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (MaxLight 650 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLF5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF5 klf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.