Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CASP6 rabbit polyclonal antibody. Western Blot analysis of CASP6 expression in mouse lung.)

Rabbit anti-Human, Mouse Caspase-6 Polyclonal Antibody | anti-CASP6 antibody

Caspase-6 (CASP-6, Apoptotic protease Mch-2, CASP6, MCH2) APC

Gene Names
CASP6; MCH2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Caspase-6; Polyclonal Antibody; Caspase-6 (CASP-6; Apoptotic protease Mch-2; CASP6; MCH2) APC; anti-CASP6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CASP6. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CASP6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CASP6, aa1-293 (NP_001217.2).
Immunogen Sequence
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CASP6 rabbit polyclonal antibody. Western Blot analysis of CASP6 expression in mouse lung.)

Western Blot (WB) (CASP6 rabbit polyclonal antibody. Western Blot analysis of CASP6 expression in mouse lung.)

Western Blot (WB)

(Western Blot analysis of CASP6 expression in transfected 293T cell line by CASP6 polyclonal antibody. Lane 1: CASP6 transfected lysate (33.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CASP6 expression in transfected 293T cell line by CASP6 polyclonal antibody. Lane 1: CASP6 transfected lysate (33.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP6 and APP. HeLa cells were stained with CASP6 rabbit purified polyclonal 1:1200 and APP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP6 and APP. HeLa cells were stained with CASP6 rabbit purified polyclonal 1:1200 and APP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CASP6 antibody
Members of the inflammatory caspase subfamily are generally not involved in cell death but are associated with the immune response to microbial pathogens. The apoptotic subfamily can be further divided into initiator caspases, which are activated in response to death signals, and executioner caspases, which are activated by the initiator caspases and are responsible for cleavage of cellular substrates that ultimately lead to cell death. Caspase-6 is an executioner caspase that was identified based on its homology with human caspases 2 and 3 as well as the C. elegans cell death protein CED-3. It possesses two isoforms, of which only the longer form possesses protease activity. Caspase-6 is highly expressed in adult brains and may play a role in several neuronal pathologies.
Product Categories/Family for anti-CASP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
839
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,310 Da
NCBI Official Full Name
caspase-6 isoform alpha preproprotein
NCBI Official Synonym Full Names
caspase 6, apoptosis-related cysteine peptidase
NCBI Official Symbol
CASP6
NCBI Official Synonym Symbols
MCH2
NCBI Protein Information
caspase-6; apoptotic protease MCH-2; caspase 6, apoptosis-related cysteine protease
UniProt Protein Name
Caspase-6
Protein Family
UniProt Gene Name
CASP6
UniProt Synonym Gene Names
MCH2; CASP-6
UniProt Entry Name
CASP6_HUMAN

NCBI Description

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in two transcript variants that encode different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

CASP6: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves poly(ADP-ribose) polymerase in vitro, as well as lamins. Overexpression promotes programmed cell death. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 18 kDa (p18) and a 11 kDa (p11) subunit. Interacts with BIRC6/bruce. Activation is suppressed by phosphorylation at Ser-257. Belongs to the peptidase C14A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.22.59; Protease; Apoptosis

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: identical protein binding; protein binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity

Biological Process: epithelial cell differentiation; apoptosis; proteolysis; cell structure disassembly during apoptosis

Research Articles on CASP6

Similar Products

Product Notes

The CASP6 casp6 (Catalog #AAA6372290) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Caspase-6 (CASP-6, Apoptotic protease Mch-2, CASP6, MCH2) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Caspase-6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CASP6 casp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Caspase-6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.