Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human KLF2 Monoclonal Antibody | anti-KLF2 antibody

KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF)

Gene Names
KLF2; LKLF
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KLF2; Monoclonal Antibody; KLF2 (Kruppel-like Factor 2; Lung Kruppel-like Factor; LKLF; Lung Kruppel-like Zinc Finger Transcription Factor; Kruppel-like Factor LKLF); Anti -KLF2 (Kruppel-like Factor 2; anti-KLF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D1
Specificity
Recognizes human KLF2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
Applicable Applications for anti-KLF2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in Western Blot and ELISA.
Immunogen
Partial recombinant corresponding to aa263-350 from KLF2 (NP_057354) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)
Related Product Information for anti-KLF2 antibody
KLF2 (Kruppel-like factor 2; endothelium, monocytes, Taa in length. It contains an activation domain aa1-110, an inhibitory domain aa111-267, and three C2H2-type zinc-finger regions aa272-354. There is one potential splice form that shows a premature truncation after Asp224. Over aa71-168, human KLF2 is 82aa identical to mouse KLF2. also LKLF) is a lung-associated, 37kD member of the Kruppel C2H2-type zinc-finger protein family. KLF2 is found in airway epithelium, and B cells. It is a transcription factor that regulates multiple genes, many of which are involved in cell migration.
Product Categories/Family for anti-KLF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,420 Da
NCBI Official Full Name
Krueppel-like factor 2
NCBI Official Synonym Full Names
Kruppel-like factor 2 (lung)
NCBI Official Symbol
KLF2
NCBI Official Synonym Symbols
LKLF
NCBI Protein Information
Krueppel-like factor 2; Kruppel-like factor LKLF; lung krueppel-like factor; lung Kruppel-like zinc finger transcription factor
UniProt Protein Name
Krueppel-like factor 2
Protein Family
UniProt Gene Name
KLF2
UniProt Synonym Gene Names
LKLF
UniProt Entry Name
KLF2_HUMAN

NCBI Description

Kruppel-like factors (KLFs) are a family of broadly expressed zinc finger transcription factors. KLF2 regulates T-cell trafficking by promoting expression of the lipid-binding receptor S1P1 (S1PR1; MIM 601974) and the selectin CD62L (SELL; MIM 153240) (summary by Weinreich et al., 2009 [PubMed 19592277]).[supplied by OMIM, Feb 2011]

Uniprot Description

KLF2: Binds to the CACCC box in the beta-globin gene promoter and activates transcription. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding; metal ion binding; transcription factor activity

Biological Process: erythrocyte maturation; transcription, DNA-dependent; in utero embryonic development; multicellular organism growth; negative regulation of interleukin-6 production; cell morphogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein metabolic process; regulation of gene expression, epigenetic

Research Articles on KLF2

Similar Products

Product Notes

The KLF2 klf2 (Catalog #AAA642256) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in Western Blot and ELISA. Researchers should empirically determine the suitability of the KLF2 klf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SWPRKRTATH TCSYAGCGKT YTKSSHLKAH LRTHTGEKPY HCNWDGCGWK FARSDELTRH YRKHTGHRPF QCHLCDRAFS RSDHLALH. It is sometimes possible for the material contained within the vial of "KLF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.