Mouse anti-Human KLF2 Monoclonal Antibody | anti-KLF2 antibody

KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) APC

Cat. Num. AAA6137310

• Gene Names: KLF2; LKLF
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KLF2; Monoclonal Antibody; KLF2 (Kruppel-like Factor 2; Lung Kruppel-like Factor; LKLF; Lung Kruppel-like Zinc Finger Transcription Factor; Kruppel-like Factor LKLF) APC; anti-KLF2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D1
• Specificity: Recognizes human KLF2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 2820

• Applicable Applications for anti-KLF2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa263-350 from KLF2 (NP_057354) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Related Product Information for anti-KLF2 antibody

KLF2 (Kruppel-like factor 2; endothelium, monocytes, Taa in length. It contains an activation domain aa1-110, an inhibitory domain aa111-267, and three C2H2-type zinc-finger regions aa272-354. There is one potential splice form that shows a premature truncation after Asp224. Over aa71-168, human KLF2 is 82aa identical to mouse KLF2. also LKLF) is a lung-associated, 37kD member of the Kruppel C2H2-type zinc-finger protein family. KLF2 is found in airway epithelium, and B cells. It is a transcription factor that regulates multiple genes, many of which are involved in cell migration.

Product Categories/Family for anti-KLF2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1732746356
• NCBI GeneID: 10365
• NCBI Accession #: NM_016270.4
• NCBI GenBank Nucleotide #: NM_016270
• UniProt Accession #: Q9Y5W3
• NCBI Official Full Name: Homo sapiens Kruppel like factor 2 (KLF2), mRNA
• NCBI Official Synonym Full Names: Kruppel like factor 2
• NCBI Official Symbol: KLF2
• NCBI Official Synonym Symbols: LKLF
• NCBI Protein Information: Krueppel-like factor 2
• UniProt Protein Name: Krueppel-like factor 2
• Protein Family: Krueppel-like factor
• UniProt Gene Name: KLF2
• UniProt Synonym Gene Names: LKLF

NCBI Description

This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is expressed early in mammalian development and is found in many different cell types. The protein acts to bind the CACCC box found in the promoter of target genes to activate their transcription. It plays a role in many processes during development and disease including adipogenesis, embryonic erythropoiesis, epithelial integrity, inflammation and t-cell viability. [provided by RefSeq, Mar 2017]

Uniprot Description

Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription.