Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse KLF11 Monoclonal Antibody | anti-KLF11 antibody

KLF11 (Kruppel-like Factor 11, FKLF, FKLF1, MODY7, TIEG2, Tieg3) (MaxLight 650)

Gene Names
KLF11; FKLF; FKLF1; MODY7; TIEG2; Tieg3
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
KLF11; Monoclonal Antibody; KLF11 (Kruppel-like Factor 11; FKLF; FKLF1; MODY7; TIEG2; Tieg3) (MaxLight 650); Kruppel-like Factor 11; Tieg3; anti-KLF11 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
10D8
Specificity
Recognizes KLF11.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-KLF11 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KLF11 (NP_003588, 404aa-512aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-KLF11 antibody
Mouse monoclonal antibody raised against a partial recombinant KLF11.
Product Categories/Family for anti-KLF11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
Krueppel-like factor 11 isoform a
NCBI Official Synonym Full Names
Kruppel like factor 11
NCBI Official Symbol
KLF11
NCBI Official Synonym Symbols
FKLF; FKLF1; MODY7; TIEG2; Tieg3
NCBI Protein Information
Krueppel-like factor 11
UniProt Protein Name
Krueppel-like factor 11
Protein Family
UniProt Gene Name
KLF11
UniProt Synonym Gene Names
FKLF; TIEG2; TGFB-inducible early growth response protein 2; TIEG-2
UniProt Entry Name
KLF11_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset diabetes of the young type 7 (MODY7). Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

Uniprot Description

TIEG2: Transcription factor. Activates the epsilon- and gamma- globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling. Induces apoptosis. Defects in KLF11 are the cause of maturity-onset diabetes of the young type 7 (MODY7). MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. Belongs to the Sp1 C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein; Transcription factor

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: nucleus

Molecular Function: metal ion binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; G1/S-specific transcription in mitotic cell cycle; negative regulation of cell proliferation; positive regulation of apoptosis; apoptosis; negative regulation of transcription from RNA polymerase II promoter

Disease: Maturity-onset Diabetes Of The Young, Type 7

Research Articles on KLF11

Similar Products

Product Notes

The KLF11 klf11 (Catalog #AAA6228430) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KLF11 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF11 klf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.