Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KLF10 monoclonal antibody. Western Blot analysis of KLF10 expression in K-562.)

Mouse anti-Human KLF10 Monoclonal Antibody | anti-KLF10 antibody

KLF10 (Krueppel-like Factor 10, EGR-alpha, Transforming Growth Factor-beta-inducible Early Growth Response Protein 1, TGFB-inducible Early Growth Response Protein 1, TIEG-1, TIEG, TIEG1) (AP)

Gene Names
KLF10; EGRA; TIEG; TIEG1; EGR-alpha
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLF10; Monoclonal Antibody; KLF10 (Krueppel-like Factor 10; EGR-alpha; Transforming Growth Factor-beta-inducible Early Growth Response Protein 1; TGFB-inducible Early Growth Response Protein 1; TIEG-1; TIEG; TIEG1) (AP); anti-KLF10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4G9
Specificity
Recognizes human KLF10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-KLF10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human KLF10 (AAH11538) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(KLF10 monoclonal antibody. Western Blot analysis of KLF10 expression in K-562.)

Western Blot (WB) (KLF10 monoclonal antibody. Western Blot analysis of KLF10 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KLF10 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to KLF10 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-KLF10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
13,702 Da
NCBI Official Full Name
Homo sapiens Kruppel-like factor 10, mRNA
NCBI Official Synonym Full Names
Kruppel like factor 10
NCBI Official Symbol
KLF10
NCBI Official Synonym Symbols
EGRA; TIEG; TIEG1; EGR-alpha
NCBI Protein Information
Krueppel-like factor 10
Protein Family

NCBI Description

This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]

Research Articles on KLF10

Similar Products

Product Notes

The KLF10 (Catalog #AAA6132002) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLF10 (Krueppel-like Factor 10, EGR-alpha, Transforming Growth Factor-beta-inducible Early Growth Response Protein 1, TGFB-inducible Early Growth Response Protein 1, TIEG-1, TIEG, TIEG1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLF10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.