Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Mouse anti-Human KIRREL3 Monoclonal Antibody | anti-KIRREL3 antibody
KIRREL3 (Kin of IRRE-like protein 3, Kin of irregular chiasm-like protein 3, Nephrin-like protein 2, KIAA1867, NEPH2, UNQ5923/PRO4502/PRO19814, MGC126824, MGC126850) (Biotin)
Gene Names
KIRREL3; MRD4; KIRRE; NEPH2; PRO4502
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KIRREL3; Monoclonal Antibody; KIRREL3 (Kin of IRRE-like protein 3; Kin of irregular chiasm-like protein 3; Nephrin-like protein 2; KIAA1867; NEPH2; UNQ5923/PRO4502/PRO19814; MGC126824; MGC126850) (Biotin); anti-KIRREL3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A12
Specificity
Recognizes human KIRREL3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-KIRREL3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa679-779 from human KIRREL3 (NP_115920) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YSTLSGQGRLYDYGQRFVLGMGSSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPLQRRMQTHV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-KIRREL3 antibody
Could be involved in the hematopoietic supportive capacity of stroma cells.
Product Categories/Family for anti-KIRREL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65,308 Da
NCBI Official Full Name
kin of IRRE-like protein 3 isoform 1
NCBI Official Synonym Full Names
kin of IRRE like 3 (Drosophila)
NCBI Official Symbol
KIRREL3
NCBI Official Synonym Symbols
MRD4; KIRRE; NEPH2; PRO4502
NCBI Protein Information
kin of IRRE-like protein 3
Protein Family
NCBI Description
The protein encoded by this gene is a member of the nephrin-like protein family. These proteins are expressed in fetal and adult brain, and also in podocytes of kidney glomeruli. The cytoplasmic domains of these proteins interact with the C-terminus of podocin, also expressed in the podocytes, cells involved in ensuring size- and charge-selective ultrafiltration. Mutations in this gene are associated with mental retardation autosomal dominant type 4 (MRD4). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]
Research Articles on KIRREL3
Similar Products
Product Notes
The KIRREL3 (Catalog #AAA6142605) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KIRREL3 (Kin of IRRE-like protein 3, Kin of irregular chiasm-like protein 3, Nephrin-like protein 2, KIAA1867, NEPH2, UNQ5923/PRO4502/PRO19814, MGC126824, MGC126850) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIRREL3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KIRREL3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIRREL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
