Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using EDC3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit EDC3 Polyclonal Antibody | anti-EDC3 antibody
EDC3 Polyclonal Antibody
Gene Names
EDC3; YJDC; LSM16; MRT50; YJEFN2; hYjeF_N2-15q23
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
EDC3; Polyclonal Antibody; EDC3 Polyclonal Antibody; LSM16; YJDC; YJEFN2; anti-EDC3 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
HNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDC
Sequence Length
508
Applicable Applications for anti-EDC3 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human EDC3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, P-body
Positive Samples
U-87MG, MCF-7, HeLa, Mouse pancreas
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using EDC3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using EDC3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-EDC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 56kDa
Observed: 56kDa
Observed: 56kDa
NCBI Official Full Name
enhancer of mRNA-decapping protein 3 isoform 1
NCBI Official Synonym Full Names
enhancer of mRNA decapping 3
NCBI Official Symbol
EDC3
NCBI Official Synonym Symbols
YJDC; LSM16; MRT50; YJEFN2; hYjeF_N2-15q23
NCBI Protein Information
enhancer of mRNA-decapping protein 3
UniProt Protein Name
Enhancer of mRNA-decapping protein 3
Protein Family
UniProt Gene Name
EDC3
UniProt Synonym Gene Names
LSM16; YJDC; YJEFN2; YjeF_N2; hYjeF_N2
NCBI Description
This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability. [provided by RefSeq, May 2017]
Uniprot Description
Binds single-stranded RNA. Involved in the process of mRNA degradation and in the positive regulation of mRNA decapping. May play a role in spermiogenesis and oogenesis.
Research Articles on EDC3
Similar Products
Product Notes
The EDC3 edc3 (Catalog #AAA9133785) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDC3 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EDC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the EDC3 edc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HNSWSSSSRH PNQATPKKSG LKNGQMKNKD DECFGDDIEE IPDTDFDFEG NLALFDKAAV FEEIDTYERR SGTRSRGIPN ERPTRYRHDE NILESEPIVY RRIIVPHNVS KEFCTDSGLV VPSISYELHK KLLSVAEKHG LTLERRLEMT GVCASQMALT LLGGPNRLNP KNVHQRPTVA LLCGPHVKGA QGISCGRHLA NHDVQVILFL PNFVKMLESI TNELSLFSKT QGQQVSSLKD LPTSPVDLVI NCLDC. It is sometimes possible for the material contained within the vial of "EDC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
