Mouse anti-Human KIAA1199 Monoclonal Antibody | anti-KIAA1199 antibody

KIAA1199 (Protein KIAA1199, TMEM2L, CCSP1, IR2155535) (Biotin)

Cat. Num. AAA6142593

• Gene Names: CEMIP; CCSP1; TMEM2L; KIAA1199
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KIAA1199; Monoclonal Antibody; KIAA1199 (Protein KIAA1199; TMEM2L; CCSP1; IR2155535) (Biotin); anti-KIAA1199 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C12
• Specificity: Recognizes human KIAA1199.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-KIAA1199 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa880-980 from human KIAA1199 (NP_061159) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of KIAA1199 expression in transfected 293T cell line by KIAA1199 monoclonal antibody. Lane 1: KIAA1199 transfected lysate (110.4kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of KIAA1199 transfected lysate using KIAA1199 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with KIAA1199 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged KIAA1199 is 0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-KIAA1199 antibody

Antibodies; KIAA; orf

NCBI and Uniprot Product Information

• NCBI GI #: 38638698
• NCBI GeneID: 57214
• NCBI Accession #: NP_061159.1
• NCBI GenBank Nucleotide #: NM_018689
• UniProt Accession #: Q8WUJ3; Q6L9J5; Q9H1K5; Q9NPN9; Q9ULM1
• Molecular Weight: 152,998 Da
• NCBI Official Full Name: cell migration-inducing and hyaluronan-binding protein
• NCBI Official Synonym Full Names: cell migration inducing protein, hyaluronan binding
• NCBI Official Symbol: CEMIP
• NCBI Official Synonym Symbols: CCSP1; TMEM2L; KIAA1199
• NCBI Protein Information: cell migration-inducing and hyaluronan-binding protein; colon cancer secreted protein 1
• UniProt Protein Name: Cell migration-inducing and hyaluronan-binding protein
• UniProt Gene Name: CEMIP
• UniProt Synonym Gene Names: KIAA1199

Uniprot Description

Mediates depolymerization of hyaluronic acid (HA) via the cell membrane-associated clathrin-coated pit endocytic pathway. Binds to hyaluronic acid. Hydrolyzes high molecular weight hyaluronic acid to produce an intermediate-sized product, a process that may occur through rapid vesicle endocytosis and recycling without intracytoplasmic accumulation or digestion in lysosomes. Involved in hyaluronan catabolism in the dermis of the skin and arthritic synovium. Positively regulates epithelial-mesenchymal transition (EMT), and hence tumor cell growth, invasion and cancer dissemination. In collaboration with HSPA5/BIP, promotes cancer cell migration in a calcium and PKC-dependent manner. May be involved in hearing.