Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged KEL is 1ng/ml as a capture antibody.)

Mouse anti-Human KEL Monoclonal Antibody | anti-KEL antibody

KEL (Kell Blood Group Glycoprotein, CD238) (PE)

Gene Names
KEL; ECE3; CD238
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KEL; Monoclonal Antibody; KEL (Kell Blood Group Glycoprotein; CD238) (PE); anti-KEL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B10
Specificity
Recognizes human KEL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-KEL antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa633-732 from human KEL (NP_000411.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LENAADVGGLAIALQAYSKRLLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLRVHGPLSSTPAFARYFRCARGALLNPSSRCQLW
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged KEL is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KEL is 1ng/ml as a capture antibody.)
Related Product Information for anti-KEL antibody
Zinc endopeptidase with endothelin-3-converting enzyme activity. Cleaves EDN1, EDN2 and EDN3, with a marked preference for EDN3.
Product Categories/Family for anti-KEL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,824 Da
NCBI Official Full Name
kell blood group glycoprotein
NCBI Official Synonym Full Names
Kell blood group, metallo-endopeptidase
NCBI Official Symbol
KEL
NCBI Official Synonym Symbols
ECE3; CD238
NCBI Protein Information
kell blood group glycoprotein; kell blood group antigen
UniProt Protein Name
Kell blood group glycoprotein
Protein Family
UniProt Gene Name
KEL
UniProt Entry Name
KELL_HUMAN

NCBI Description

This gene encodes a type II transmembrane glycoprotein that is the highly polymorphic Kell blood group antigen. The Kell glycoprotein links via a single disulfide bond to the XK membrane protein that carries the Kx antigen. The encoded protein contains sequence and structural similarity to members of the neprilysin (M13) family of zinc endopeptidases. [provided by RefSeq, Jul 2008]

Uniprot Description

KEL: Zinc endopeptidase with endothelin-3-converting enzyme activity. Cleaves EDN1, EDN2 and EDN3, with a marked preference for EDN3. Belongs to the peptidase M13 family.

Protein type: Membrane protein, integral; Protease; EC 3.4.24.-

Chromosomal Location of Human Ortholog: 7q33

Cellular Component: plasma membrane; integral to membrane

Molecular Function: protein binding; metalloendopeptidase activity; metal ion binding

Biological Process: cellular calcium ion homeostasis; myelination; vasoconstriction; regulation of axon diameter; skeletal muscle fiber development; proteolysis; regulation of cell size

Disease: Blood Group--kell System

Research Articles on KEL

Similar Products

Product Notes

The KEL kel (Catalog #AAA6158493) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KEL (Kell Blood Group Glycoprotein, CD238) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KEL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KEL kel for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KEL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.