Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (53.61kD).)

Mouse anti-Human KCNIP4 Monoclonal Antibody | anti-KCNIP4 antibody

KCNIP4 (CALP, KCHIP4, Kv Channel-interacting Protein 4, A-type Potassium Channel Modulatory Protein 4, Calsenilin-like Protein, Potassium Channel-interacting Protein 4, MGC44947)

Gene Names
KCNIP4; CALP; KCHIP4
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KCNIP4; Monoclonal Antibody; KCNIP4 (CALP; KCHIP4; Kv Channel-interacting Protein 4; A-type Potassium Channel Modulatory Protein 4; Calsenilin-like Protein; Potassium Channel-interacting Protein 4; MGC44947); Anti -KCNIP4 (CALP; anti-KCNIP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A11
Specificity
Recognizes human KCNIP4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
Applicable Applications for anti-KCNIP4 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length recombinant corresponding to aa1-251 from human KCNIP4 (AAH32520) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (53.61kD).)

Western Blot (WB) (Western Blot detection against Immunogen (53.61kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KCNIP4 on HeLa cell . [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to KCNIP4 on HeLa cell . [antibody concentration 10ug/ml].)
Related Product Information for anti-KCNIP4 antibody
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-KCNIP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,729 Da
NCBI Official Full Name
Kv channel-interacting protein 4 isoform 3
NCBI Official Synonym Full Names
Kv channel interacting protein 4
NCBI Official Symbol
KCNIP4
NCBI Official Synonym Symbols
CALP; KCHIP4
NCBI Protein Information
Kv channel-interacting protein 4; calsenilin-like protein; potassium channel interacting protein 4; potassium channel-interacting protein 4; a-type potassium channel modulatory protein 4
UniProt Protein Name
Kv channel-interacting protein 4
UniProt Gene Name
KCNIP4
UniProt Synonym Gene Names
CALP; KCHIP4; KChIP4
UniProt Entry Name
KCIP4_HUMAN

NCBI Description

This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNIP4: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Belongs to the recoverin family. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 4p15.32

Cellular Component: voltage-gated potassium channel complex; cell soma; cytoplasm; dendrite; plasma membrane; cytosol

Molecular Function: potassium channel regulator activity; potassium channel activity; voltage-gated ion channel activity; calcium ion binding

Research Articles on KCNIP4

Similar Products

Product Notes

The KCNIP4 kcnip4 (Catalog #AAA6011563) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNIP4 (CALP, KCHIP4, Kv Channel-interacting Protein 4, A-type Potassium Channel Modulatory Protein 4, Calsenilin-like Protein, Potassium Channel-interacting Protein 4, MGC44947) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNIP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the KCNIP4 kcnip4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNVRRVESIS AQLEEASSTG GFLYAQNSTK RSIKERLMKL LPCSAAKTSS PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI. It is sometimes possible for the material contained within the vial of "KCNIP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.