Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged KCNG3 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human KCNG3 Monoclonal Antibody | anti-KCNG3 antibody

KCNG3 (Potassium Voltage-gated Channel Subfamily G Member 3, Voltage-gated Potassium Channel Subunit Kv10.1, Voltage-gated Potassium Channel Subunit Kv6.3) (Biotin)

Gene Names
KCNG3; KV6.3; KV10.1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KCNG3; Monoclonal Antibody; KCNG3 (Potassium Voltage-gated Channel Subfamily G Member 3; Voltage-gated Potassium Channel Subunit Kv10.1; Voltage-gated Potassium Channel Subunit Kv6.3) (Biotin); anti-KCNG3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5H2
Specificity
Recognizes human KCNG3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
436
Applicable Applications for anti-KCNG3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa23-122 from human KCNG3 (NP_579875) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged KCNG3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KCNG3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-KCNG3 antibody
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member is a gamma subunit functioning as a modulatory molecule.
Product Categories/Family for anti-KCNG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
potassium voltage-gated channel subfamily G member 3 isoform 1
NCBI Official Synonym Full Names
potassium voltage-gated channel modifier subfamily G member 3
NCBI Official Symbol
KCNG3
NCBI Official Synonym Symbols
KV6.3; KV10.1
NCBI Protein Information
potassium voltage-gated channel subfamily G member 3
UniProt Protein Name
Potassium voltage-gated channel subfamily G member 3
UniProt Gene Name
KCNG3
UniProt Entry Name
KCNG3_HUMAN

NCBI Description

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member is a gamma subunit functioning as a modulatory molecule. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNG3: Potassium channel subunit. Modulates channel activity. Belongs to the potassium channel family. G (TC 1.A.1.2) subfamily. Kv6.3/KCNG3 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 2p21

Cellular Component: voltage-gated potassium channel complex; endoplasmic reticulum; integral to membrane; plasma membrane

Molecular Function: protein binding; delayed rectifier potassium channel activity

Biological Process: synaptic transmission; protein homooligomerization

Research Articles on KCNG3

Similar Products

Product Notes

The KCNG3 kcng3 (Catalog #AAA6142568) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNG3 (Potassium Voltage-gated Channel Subfamily G Member 3, Voltage-gated Potassium Channel Subunit Kv10.1, Voltage-gated Potassium Channel Subunit Kv6.3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNG3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNG3 kcng3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNG3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.