Mouse anti-Human KCNE1 Monoclonal Antibody | anti-KCNE1 antibody

KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, FLJ18426, FLJ38123, FLJ94103, MGC33114)

Cat. Num. AAA644080

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: KCNE1; Monoclonal Antibody; KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1; Delayed Rectifier Potassium Channel Subunit IsK; IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink; ISK; Minimal Potassium Channel; FLJ18426; FLJ38123; FLJ94103; MGC33114); Anti -KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1; anti-KCNE1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5B12
• Specificity: Recognizes human KCNE1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP

• Applicable Applications for anti-KCNE1 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa67-129 from human KCNE1 (NP_000210) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.67kD).)

Western Blot (WB)

(Western Blot analysis of KCNE1 expression in transfected 293T cell line by KCNE1 monoclonal antibody.|Lane 1: KCNE1 transfected lysate (14.7kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KCNE1 is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-KCNE1 antibody

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq]

Product Categories/Family for anti-KCNE1 antibody

Antibodies; Abs to Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 49456471
• UniProt Accession #: Q6FHJ6
• Molecular Weight: 14,645 Da
• NCBI Official Full Name: KCNE1
• UniProt Protein Name: KCNE1 protein
• Protein Family: Potassium voltage-gated channel subfamily
• UniProt Gene Name: KCNE1
• UniProt Entry Name: Q6FHJ6_HUMAN

NCBI Description

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]