Mouse anti-Human KCNE1 Monoclonal Antibody | anti-KCNE1 antibody

KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, FLJ18426, FLJ38123, FLJ94103, MGC33114) (AP

Cat. Num. AAA6131959

• Gene Names: KCNE1; ISK; JLNS; LQT5; MinK; JLNS2; LQT2/5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KCNE1; Monoclonal Antibody; KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1; Delayed Rectifier Potassium Channel Subunit IsK; IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink; ISK; Minimal Potassium Channel; FLJ18426; FLJ38123; FLJ94103; MGC33114) (AP; anti-KCNE1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5B12
• Specificity: Recognizes human KCNE1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 129

• Applicable Applications for anti-KCNE1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa67-129 from human KCNE1 (NP_000210) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.67kD).)

Western Blot (WB)

(Western Blot analysis of KCNE1 expression in transfected 293T cell line by KCNE1 monoclonal antibody. Lane 1: KCNE1 transfected lysate (14.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KCNE1 is ~3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-KCNE1 antibody

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq]

Product Categories/Family for anti-KCNE1 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 60218915
• NCBI GeneID: 3753
• NCBI Accession #: NP_000210
• NCBI GenBank Nucleotide #: NM_000219
• UniProt Accession #: P15382
• NCBI Official Full Name: potassium voltage-gated channel subfamily E member 1
• NCBI Official Synonym Full Names: potassium voltage-gated channel subfamily E regulatory subunit 1
• NCBI Official Symbol: KCNE1
• NCBI Official Synonym Symbols: ISK; JLNS; LQT5; MinK; JLNS2; LQT2/5
• NCBI Protein Information: potassium voltage-gated channel subfamily E member 1
• UniProt Protein Name: Potassium voltage-gated channel subfamily E member 1
• Protein Family: Potassium voltage-gated channel subfamily
• UniProt Gene Name: KCNE1
• UniProt Entry Name: KCNE1_HUMAN

NCBI Description

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNE1: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr). Associates with KCNQ1/KVLQT1 and KCNH2/HERG. Expressed in heart, lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells. Belongs to the potassium channel KCNE family.

Protein type: Membrane protein, integral; Channel, potassium

Chromosomal Location of Human Ortholog: 21q22.12

Cellular Component: voltage-gated potassium channel complex; cell surface; lysosome; apical plasma membrane; plasma membrane; Z disc

Molecular Function: voltage-gated potassium channel activity; protein binding; potassium channel regulator activity; telethonin binding; delayed rectifier potassium channel activity

Biological Process: protein amino acid O-linked glycosylation; sensory perception of sound; protein amino acid N-linked glycosylation

Disease: Jervell And Lange-nielsen Syndrome 2; Long Qt Syndrome 5