Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit is 0.3ng/ml using as a capture antibody.)

Mouse anti-Human Kallikrein 5 Monoclonal Antibody | anti-KLK5 antibody

Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) APC

Gene Names
KLK5; SCTE; KLKL2; KLK-L2
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Kallikrein 5; Monoclonal Antibody; Kallikrein 5 (Kallikrein-5; KLK5; Kallikrein-like Protein 2; KLKL2; KLK-L2; Kallikrein-related Peptidase 5; Stratum Corneum Tryptic Enzyme; SCTE; UNQ570/PRO1132) APC; anti-KLK5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H3
Specificity
Recognizes human Kallikrein 5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
293
Applicable Applications for anti-KLK5 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa194-293 from human Kallikrein 5 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit is 0.3ng/ml using as a capture antibody.)

Testing Data (Detection limit is 0.3ng/ml using as a capture antibody.)
Related Product Information for anti-KLK5 antibody
Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. A novel KLK gene, KLK12, is expressed in a variety of tissues including salivary gland, stomach, uterus, lung, thymus, prostate, colon, brain, breast, thyroid, and trachea. It has applications as a novel cancer biomarker.
Product Categories/Family for anti-KLK5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
kallikrein-5 preproprotein
NCBI Official Synonym Full Names
kallikrein related peptidase 5
NCBI Official Symbol
KLK5
NCBI Official Synonym Symbols
SCTE; KLKL2; KLK-L2
NCBI Protein Information
kallikrein-5
UniProt Protein Name
Kallikrein-5
Protein Family
UniProt Gene Name
KLK5
UniProt Synonym Gene Names
SCTE; KLK-L2
UniProt Entry Name
KLK5_HUMAN

NCBI Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its expression is up-regulated by estrogens and progestins. The encoded protein is secreted and may be involved in desquamation in the epidermis. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

KLK5: May be involved in desquamation. Belongs to the peptidase S1 family. Kallikrein subfamily.

Protein type: EC 3.4.21.-; Protease; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: extracellular space

Molecular Function: peptidase activity; protein binding; serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: epidermis development; positive regulation of G-protein coupled receptor protein signaling pathway; proteolysis

Research Articles on KLK5

Similar Products

Product Notes

The KLK5 klk5 (Catalog #AAA6137255) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Kallikrein 5 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLK5 klk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Kallikrein 5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.