Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged KAL1 is approximately 0.1ng/ml as a capture antibody.)

Mouse KAL1 Monoclonal Antibody | anti-KAL1 antibody

KAL1 (Kallmann Syndrome 1 Sequence, ADMLX, HHA, KAL, KALIG-1, KMS) (FITC)

Gene Names
KAL1; HH1; HHA; KAL; KMS; ADMLX; WFDC19; KALIG-1
Applications
Western Blot
Purity
Purified
Synonyms
KAL1; Monoclonal Antibody; KAL1 (Kallmann Syndrome 1 Sequence; ADMLX; HHA; KAL; KALIG-1; KMS) (FITC); Kallmann Syndrome 1 Sequence; KMS; anti-KAL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C9
Specificity
Recognizes KAL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-KAL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
KAL1 (NP_000207, 548aa-657aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRTPELPP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged KAL1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KAL1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-KAL1 antibody
Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity. [provided by RefSeq]
Product Categories/Family for anti-KAL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,112 Da
NCBI Official Full Name
anosmin-1
NCBI Official Synonym Full Names
Kallmann syndrome 1 sequence
NCBI Official Symbol
KAL1
NCBI Official Synonym Symbols
HH1; HHA; KAL; KMS; ADMLX; WFDC19; KALIG-1
NCBI Protein Information
anosmin-1; kallmann syndrome protein; adhesion molecule-like X-linked; Kallmann syndrome interval gene 1; WAP four-disulfide core domain 19; Kallmann syndrome-1 sequence (anosmin-1)
UniProt Protein Name
Anosmin-1
UniProt Gene Name
KAL1
UniProt Synonym Gene Names
ADMLX; KAL; KALIG1
UniProt Entry Name
KALM_HUMAN

NCBI Description

Mutations in this gene cause the X-linked Kallmann syndrome. The encoded protein is similar in sequence to proteins known to function in neural cell adhesion and axonal migration. In addition, this cell surface protein is N-glycosylated and may have anti-protease activity. [provided by RefSeq, Jul 2008]

Uniprot Description

KAL1: Has a dual branch-promoting and guidance activity, which may play an important role in the patterning of mitral and tufted cell collaterals to the olfactory cortex. Chemoattractant for fetal olfactory epithelial cells. Defects in KAL1 are the cause of Kallmann syndrome type 1 (KAL1); also known as hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin- releasing hormone-synthesizing neurons. In some patients other developmental anomalies can be present, which include renal agenesis, cleft lip and/or palate, selective tooth agenesis, and bimanual synkinesis. In some cases anosmia may be absent or inconspicuous.

Protein type: Motility/polarity/chemotaxis; Extracellular matrix

Chromosomal Location of Human Ortholog: Xp22.32

Cellular Component: proteinaceous extracellular matrix; extracellular space; plasma membrane

Molecular Function: heparin binding; serine-type endopeptidase inhibitor activity; protein binding; extracellular matrix structural constituent

Biological Process: axon guidance; chemotaxis; cell adhesion; cell motility

Disease: Hypogonadotropic Hypogonadism 1 With Or Without Anosmia

Research Articles on KAL1

Similar Products

Product Notes

The KAL1 kal1 (Catalog #AAA6177114) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KAL1 kal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KAL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.