Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.25kD).)

Mouse anti-Human ITGB1BP2 Monoclonal Antibody | anti-ITGB1BP2 antibody

ITGB1BP2 (Integrin beta-1-binding Protein 2, Melusin, MSTP015) (Biotin)

Gene Names
ITGB1BP2; CHORDC3; ITGB1BP; MELUSIN; MSTP015
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITGB1BP2; Monoclonal Antibody; ITGB1BP2 (Integrin beta-1-binding Protein 2; Melusin; MSTP015) (Biotin); anti-ITGB1BP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G9
Specificity
Recognizes human ITGB1BP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1280
Applicable Applications for anti-ITGB1BP2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa246-320 from human ITGB1BP2 (NP_036410) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVL*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.25kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.25kD).)
Related Product Information for anti-ITGB1BP2 antibody
ITGB1BP2 may play a role during maturation and/or organization of muscles cells.
Product Categories/Family for anti-ITGB1BP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens integrin subunit beta 1 binding protein 2 (ITGB1BP2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
integrin subunit beta 1 binding protein 2
NCBI Official Symbol
ITGB1BP2
NCBI Official Synonym Symbols
CHORDC3; ITGB1BP; MELUSIN; MSTP015
NCBI Protein Information
integrin beta-1-binding protein 2
UniProt Protein Name
Integrin beta-1-binding protein 2
UniProt Gene Name
ITGB1BP2
UniProt Entry Name
ITBP2_HUMAN

NCBI Description

This gene encodes a protein with two cysteine and histidine-rich (CHORD) domains, PXXP motifs, YXXI/P motifs, putative SH2 and SH3 domain binding motifs, and an acidic region at the C-terminus that can bind calcium. Two hybrid analysis showed that this protein interacts with the cytoplasmic domain of the beta 1 integrin subunit and is thought to act as a chaperone protein. Studies in the mouse ortholog of this gene indicate that absence of this gene in mouse results in failed cardiac hypertrophy in response to mechanical stress. Alternative splicing results in multiple transcript variants encoding different isoforms, including an isoform that lacks several domains, including one of the CHORD domains. [provided by RefSeq, May 2017]

Uniprot Description

ITGB1BP2: May play a role during maturation and/or organization of muscles cells.

Chromosomal Location of Human Ortholog: Xq12-q13.1

Cellular Component: Z disc

Molecular Function: integrin binding; protein binding; zinc ion binding; calcium ion binding; SH3 domain binding

Biological Process: muscle development; signal transduction

Research Articles on ITGB1BP2

Similar Products

Product Notes

The ITGB1BP2 itgb1bp2 (Catalog #AAA6142527) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGB1BP2 (Integrin beta-1-binding Protein 2, Melusin, MSTP015) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB1BP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITGB1BP2 itgb1bp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGB1BP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.