Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.39kD).)

Mouse anti-Human ITGAE Monoclonal Antibody | anti-ITGAE antibody

ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, Integrin alpha-E Light Chain, Integrin alpha-E Heavy Chain, MGC141996) APC

Gene Names
ITGAE; CD103; HUMINAE
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITGAE; Monoclonal Antibody; ITGAE (Integrin alpha-E; HML-1 Antigen; Integrin alpha-IEL; Mucosal Lymphocyte 1 Antigen; CD103; Integrin alpha-E Light Chain; Integrin alpha-E Heavy Chain; MGC141996) APC; anti-ITGAE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
6B8
Specificity
Recognizes human ITGAE.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1179
Applicable Applications for anti-ITGAE antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa57-171 from human ITGAE (NP_002199) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.39kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.39kD).)
Related Product Information for anti-ITGAE antibody
Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. ITGAE encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. [provided by RefSeq].
Product Categories/Family for anti-ITGAE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
integrin alpha-E
NCBI Official Synonym Full Names
integrin subunit alpha E
NCBI Official Symbol
ITGAE
NCBI Official Synonym Symbols
CD103; HUMINAE
NCBI Protein Information
integrin alpha-E
UniProt Protein Name
Integrin alpha-E
Protein Family
UniProt Gene Name
ITGAE
UniProt Entry Name
ITAE_HUMAN

NCBI Description

Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. [provided by RefSeq, Jul 2008]

Uniprot Description

ITGAE: Integrin alpha-E/beta-7 is a receptor for E-cadherin. It mediates adhesion of intra-epithelial T-lymphocytes to epithelial cell monolayers. Belongs to the integrin alpha chain family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: plasma membrane; integrin complex; external side of plasma membrane

Molecular Function: metal ion binding

Biological Process: integrin-mediated signaling pathway; extracellular matrix organization and biogenesis; cell adhesion

Research Articles on ITGAE

Similar Products

Product Notes

The ITGAE itgae (Catalog #AAA6137222) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGAE (Integrin alpha-E, HML-1 Antigen, Integrin alpha-IEL, Mucosal Lymphocyte 1 Antigen, CD103, Integrin alpha-E Light Chain, Integrin alpha-E Heavy Chain, MGC141996) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGAE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITGAE itgae for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGAE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.