Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.96kD).)

Mouse anti-Human ITGA4 Monoclonal Antibody | anti-ITGA4 antibody

ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit alpha, CD49d, MGC90518) (HRP)

Gene Names
ITGA9; RLC; ITGA4L; ALPHA-RLC
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITGA4; Monoclonal Antibody; ITGA4 (Integrin alpha-4; CD49 Antigen-like Family Member D; Integrin alpha-IV; VLA-4 Subunit alpha; CD49d; MGC90518) (HRP); anti-ITGA4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E4
Specificity
Recognizes human ITGA9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ITGA4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa785-886 from human ITGA9 (NP_002198) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.96kD).)
Related Product Information for anti-ITGA4 antibody
ITGA4s are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. It belongs to the integrin alpha chain family of proteins. The gene of this protein encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. CD14 is a novel ligand for alpha4beta1, exhibiting similar activation-state dependent binding characteristics as other alpha4beta1 ligands.
Product Categories/Family for anti-ITGA4 antibody
References
1. Osteopontin Is an Activator of Human Adipose Tissue Macrophages and Directly Affects Adipocyte Function. Zeyda M, Gollinger K, Todoric J, Kiefer FW, Keck M, Aszmann O, Prager G, Zlabinger GJ, Petzelbauer P, Stulnig TM.Endocrinology. 2011 Apr 5. 2. Thrombin cleaved osteopontin regulates hemopoietic stem and progenitor cell functions through interactions with {alpha}9{beta}1 and {alpha}4{beta}1 integrins. Grassinger J, Haylock DN, Storan MJ, Haines GO, Williams B, Whitty GA, Vinson AR, Be CL, Li S, Sorensen ES, Tam PP, Denhardt DT, Sheppard D, Choong PF, Nilsson SK.Blood. 2009 Jul 2;114(1):49-59. Epub 2009 May 5. 3. An Interstitial Deletion at 3p21.3 Results in the Genetic Fusion of MLH1 and ITGA9 in a Lynch Syndrome Family. Meyer C, Brieger A, Plotz G, Weber N, Passmann S, Dingermann T, Zeuzem S, Trojan J, Marschalek R.Clin Cancer Res. 2009 Feb 1;15(3):762-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114,489 Da
NCBI Official Full Name
integrin alpha-9
NCBI Official Synonym Full Names
integrin, alpha 9
NCBI Official Symbol
ITGA9
NCBI Official Synonym Symbols
RLC; ITGA4L; ALPHA-RLC
NCBI Protein Information
integrin alpha-9; integrin alpha-RLC
UniProt Protein Name
Integrin alpha-9
Protein Family
UniProt Gene Name
ITGA9
UniProt Entry Name
ITA9_HUMAN

Uniprot Description

ITGA9: Integrin alpha-9/beta-1 is a receptor for VCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G- I-E-L in cytotactin. Belongs to the integrin alpha chain family.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: basal plasma membrane; plasma membrane; integrin complex

Molecular Function: collagen binding; metal ion binding; laminin binding

Biological Process: integrin-mediated signaling pathway; neutrophil chemotaxis; axon guidance; extracellular matrix organization and biogenesis; wound healing; cell adhesion

Similar Products

Product Notes

The ITGA4 itga9 (Catalog #AAA6153127) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGA4 (Integrin alpha-4, CD49 Antigen-like Family Member D, Integrin alpha-IV, VLA-4 Subunit alpha, CD49d, MGC90518) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITGA4 itga9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGA4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.