Mouse anti-Human IRF4 Monoclonal Antibody | anti-IRF4 antibody

IRF4 (Multiple Myeloma Oncogene 1, NF-EM5, Lymphocyte-specific Interferon Regulatory Factor, LSIRF, Interferon Regulatory Factor 4, IRF-4, IRF4, MUM1, FLJ14868, FLJ22283, HSPC211, MGC131891, MGC163315, MUM-1) APC

Cat. Num. AAA6137205

• Gene Names: IRF4; MUM1; LSIRF; SHEP8; NF-EM5
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IRF4; Monoclonal Antibody; IRF4 (Multiple Myeloma Oncogene 1; NF-EM5; Lymphocyte-specific Interferon Regulatory Factor; LSIRF; Interferon Regulatory Factor 4; IRF-4; MUM1; FLJ14868; FLJ22283; HSPC211; MGC131891; MGC163315; MUM-1) APC; anti-IRF4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2D1
• Specificity: Recognizes human IRF4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-IRF4 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa342-451 from human IRF4 (NP_002451) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of IRF4 expression in transfected 293T cell line by IRF4 monoclonal antibody. Lane 1: IRF4 transfected lysate (51.8kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IRF4 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged IRF4 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of IRF4 over-expressed 293 cell line, cotransfected with IRF4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with IRF4 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-IRF4 antibody

Antibodies; Interferon

NCBI and Uniprot Product Information

• NCBI GI #: 167555104
• NCBI GeneID: 3662
• NCBI Accession #: NP_002451
• NCBI GenBank Nucleotide #: NM_002460
• UniProt Accession #: Q15306; Q5VUI7; Q99660
• Molecular Weight: 51,644 Da
• NCBI Official Full Name: interferon regulatory factor 4 isoform 1
• NCBI Official Synonym Full Names: interferon regulatory factor 4
• NCBI Official Symbol: IRF4
• NCBI Official Synonym Symbols: MUM1; LSIRF; SHEP8; NF-EM5
• NCBI Protein Information: interferon regulatory factor 4; multiple myeloma oncogene 1; lymphocyte-specific interferon regulatory factor
• UniProt Protein Name: Interferon regulatory factor 4
• Protein Family: Interferon regulatory factor
• UniProt Gene Name: IRF4
• UniProt Synonym Gene Names: MUM1; IRF-4; LSIRF
• UniProt Entry Name: IRF4_HUMAN

NCBI Description

The protein encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain. The IRFs are important in the regulation of interferons in response to infection by virus, and in the regulation of interferon-inducible genes. This family member is lymphocyte specific and negatively regulates Toll-like-receptor (TLR) signaling that is central to the activation of innate and adaptive immune systems. A chromosomal translocation involving this gene and the IgH locus, t(6;14)(p25;q32), may be a cause of multiple myeloma. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2010]

Uniprot Description

IRF4: Transcriptional activator. Binds to the interferon- stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Interacts with SPIB and DEF6. Not induced by interferons. Lymphoid cells. Belongs to the IRF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding; Oncoprotein

Chromosomal Location of Human Ortholog: 6p25-p23

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; sequence-specific DNA binding; protein-lysine N-methyltransferase activity; transcription factor binding; transcription factor activity

Biological Process: T cell activation; transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; positive regulation of interleukin-2 biosynthetic process; positive regulation of transcription, DNA-dependent; regulation of T-helper cell differentiation; myeloid dendritic cell differentiation; defense response to protozoan; peptidyl-lysine methylation; positive regulation of interleukin-4 biosynthetic process; positive regulation of interleukin-10 biosynthetic process; positive regulation of interleukin-13 biosynthetic process; negative regulation of toll-like receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of DNA binding

Disease: Skin/hair/eye Pigmentation, Variation In, 8