Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged IRAK4 is approximately 1ng/ml as a capture antibody.)

Mouse IRAK4 Monoclonal Antibody | anti-IRAK4 antibody

IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (PE)

Gene Names
IRAK4; IPD1; REN64; IRAK-4; NY-REN-64
Applications
Western Blot
Purity
Purified
Synonyms
IRAK4; Monoclonal Antibody; IRAK4 (Interleukin-1 Receptor-Associated Kinase 4; IPD1; NY-REN-64; REN64) (PE); Interleukin-1 Receptor-Associated Kinase 4; REN64; anti-IRAK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
400000000
Specificity
Recognizes IRAK4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-IRAK4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IRAK4 (NP_057207, 255aa-351aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged IRAK4 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IRAK4 is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-IRAK4 antibody
This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [supplied by RefSeq]
Product Categories/Family for anti-IRAK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,674 Da
NCBI Official Full Name
interleukin-1 receptor-associated kinase 4 isoform a
NCBI Official Synonym Full Names
interleukin 1 receptor associated kinase 4
NCBI Official Symbol
IRAK4
NCBI Official Synonym Symbols
IPD1; REN64; IRAK-4; NY-REN-64
NCBI Protein Information
interleukin-1 receptor-associated kinase 4
UniProt Protein Name
Interleukin-1 receptor-associated kinase 4
UniProt Gene Name
IRAK4
UniProt Synonym Gene Names
IRAK-4
UniProt Entry Name
IRAK4_HUMAN

NCBI Description

This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

IRAK4: a TKL kinase of the IRAK family. The interleukin-1 receptor-associated kinases are important mediators in the signal transduction of Toll-like receptor and IL1R family members, collectively referred to as TIRs.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; Protein kinase, TKL; TKL group; IRAK family

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: extracellular space; cytoplasm; plasma membrane; endosome membrane; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; interleukin-1 receptor binding; magnesium ion binding; ATP binding; protein kinase activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of smooth muscle cell proliferation; cytokine and chemokine mediated signaling pathway; cytokine production; protein amino acid phosphorylation; toll-like receptor 10 signaling pathway; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; toll-like receptor 5 signaling pathway; toll-like receptor signaling pathway; innate immune response; JNK cascade; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway

Disease: Invasive Pneumococcal Disease, Recurrent Isolated, 1; Irak4 Deficiency

Research Articles on IRAK4

Similar Products

Product Notes

The IRAK4 irak4 (Catalog #AAA6184709) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IRAK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IRAK4 irak4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IRAK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.