Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human IQGAP1 Monoclonal Antibody | anti-IQGAP1 antibody

IQGAP1 (Ras GTPase-activating-like Protein IQGAP1, p195, KIAA0051, HUMORFA01, SAR1) (MaxLight 550)

Gene Names
IQGAP1; SAR1; p195; HUMORFA01
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IQGAP1; Monoclonal Antibody; IQGAP1 (Ras GTPase-activating-like Protein IQGAP1; p195; KIAA0051; HUMORFA01; SAR1) (MaxLight 550); anti-IQGAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C5
Specificity
Recognizes human IQGAP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
1657
Applicable Applications for anti-IQGAP1 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa611-711 from IQGAP1 (NP_003861) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-IQGAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ras GTPase-activating-like protein IQGAP1
NCBI Official Synonym Full Names
IQ motif containing GTPase activating protein 1
NCBI Official Symbol
IQGAP1
NCBI Official Synonym Symbols
SAR1; p195; HUMORFA01
NCBI Protein Information
ras GTPase-activating-like protein IQGAP1
UniProt Protein Name
Ras GTPase-activating-like protein IQGAP1
UniProt Gene Name
IQGAP1
UniProt Synonym Gene Names
KIAA0051
UniProt Entry Name
IQGA1_HUMAN

NCBI Description

This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines. [provided by RefSeq, Jul 2008]

Uniprot Description

IQGAP1: Binds to activated CDC42 but does not stimulate its GTPase activity. It associates with calmodulin. Could serve as an assembly scaffold for the organization of a multimolecular complex that would interface incoming signals to the reorganization of the actin cytoskeleton at the plasma membrane. May promote neurite outgrowth. Interacts with CDC42; the interaction is demonstrated with IQGAP1 in GTP-bound and in nucleotide-free state. Interacts with RAC1. Does not interact with RHOA. Interacts with TSG101. Interacts with PAK6. Expressed in the placenta, lung, and kidney. A lower level expression is seen in the heart, liver, skeletal muscle and pancreas.

Protein type: GAPs, Ras; GAPs; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: microtubule; neuron projection; focal adhesion; leading edge; actin filament; actin cytoskeleton; microtubule cytoskeleton; nucleoplasm; extrinsic to internal side of plasma membrane; growth cone; axon; cytoplasm; plasma membrane; midbody; cell junction; lateral plasma membrane

Molecular Function: calmodulin binding; protein serine/threonine kinase activator activity; protein binding; phosphatidylinositol-3,4,5-triphosphate binding; Rac GTPase binding; protein complex binding; calcium ion binding; protein phosphatase binding; protein kinase binding; GTPase activator activity; GTPase inhibitor activity

Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; small GTPase mediated signal transduction; positive regulation of protein kinase activity; negative regulation of dephosphorylation; negative regulation of catalytic activity; energy reserve metabolic process; platelet-derived growth factor receptor signaling pathway; signal transduction; regulation of insulin secretion; regulation of cytokine production; positive regulation of GTPase activity

Research Articles on IQGAP1

Similar Products

Product Notes

The IQGAP1 iqgap1 (Catalog #AAA6212105) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IQGAP1 (Ras GTPase-activating-like Protein IQGAP1, p195, KIAA0051, HUMORFA01, SAR1) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IQGAP1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IQGAP1 iqgap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IQGAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.