Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human ILKAP Monoclonal Antibody | anti-ILKAP antibody

ILKAP (Integrin-linked Kinase-associated Serine/Threonine Phosphatase 2C, DKFZp434J2031, FLJ10181, MGC4846) (HRP)

Gene Names
ILKAP; ILKAP2; ILKAP3; PP2C-DELTA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ILKAP; Monoclonal Antibody; ILKAP (Integrin-linked Kinase-associated Serine/Threonine Phosphatase 2C; DKFZp434J2031; FLJ10181; MGC4846) (HRP); anti-ILKAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B5
Specificity
Recognizes human ILKAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ILKAP antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa293-393 from human ILKAP (NP_110395) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ILKAP on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ILKAP on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ILKAP is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ILKAP is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ILKAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,907 Da
NCBI Official Full Name
integrin-linked kinase-associated serine/threonine phosphatase 2C
NCBI Official Synonym Full Names
integrin-linked kinase-associated serine/threonine phosphatase
NCBI Official Symbol
ILKAP
NCBI Official Synonym Symbols
ILKAP2; ILKAP3; PP2C-DELTA
NCBI Protein Information
integrin-linked kinase-associated serine/threonine phosphatase 2C; integrin-linked kinase associated phosphatase; protein phosphatase 2c, delta isozyme
UniProt Protein Name
Integrin-linked kinase-associated serine/threonine phosphatase 2C
UniProt Gene Name
ILKAP
UniProt Synonym Gene Names
ILKAP
UniProt Entry Name
ILKAP_HUMAN

Uniprot Description

ILKAP: a protein serine/threonine phosphatase of the PP2C family. Can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, this protein may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in Wnt signaling pathway. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Motility/polarity/chemotaxis; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: cytoplasm

Molecular Function: protein binding; metal ion binding; protein serine/threonine phosphatase activity

Biological Process: protein amino acid dephosphorylation; regulation of DNA replication during S phase

Similar Products

Product Notes

The ILKAP ilkap (Catalog #AAA6153081) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ILKAP (Integrin-linked Kinase-associated Serine/Threonine Phosphatase 2C, DKFZp434J2031, FLJ10181, MGC4846) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ILKAP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ILKAP ilkap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ILKAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.