Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human IL6ST Monoclonal Antibody | anti-IL6ST antibody

IL6ST (Interleukin-6 Receptor Subunit beta, IL-6R-beta, Interleukin-6 Signal Transducer, Membrane Glycoprotein 130, gp130, CDw130, Oncostatin-M Receptor Subunit alpha, CD130, IL-6 Receptor Subunit beta, IL-6R Subunit beta) (HRP)

Gene Names
IL6ST; CD130; GP130; HIES4; CDW130; IL-6RB; sGP130
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL6ST; Monoclonal Antibody; IL6ST (Interleukin-6 Receptor Subunit beta; IL-6R-beta; Interleukin-6 Signal Transducer; Membrane Glycoprotein 130; gp130; CDw130; Oncostatin-M Receptor Subunit alpha; CD130; IL-6 Receptor Subunit beta; IL-6R Subunit beta) (HRP); anti-IL6ST antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A4
Specificity
Recognizes human IL6ST.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
918
Applicable Applications for anti-IL6ST antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa23-122 from human IL6ST (NP_002175) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(IL6ST monoclonal antibody Western Blot analysis of IL6ST expression in HepG2.)

Western Blot (WB) (IL6ST monoclonal antibody Western Blot analysis of IL6ST expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged IL6ST is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged IL6ST is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-IL6ST antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-6 receptor subunit beta isoform 1
NCBI Official Synonym Full Names
interleukin 6 signal transducer
NCBI Official Symbol
IL6ST
NCBI Official Synonym Symbols
CD130; GP130; HIES4; CDW130; IL-6RB; sGP130
NCBI Protein Information
interleukin-6 receptor subunit beta
UniProt Protein Name
Interleukin-6 receptor subunit beta
Protein Family
UniProt Gene Name
IL6ST
UniProt Synonym Gene Names
IL-6 receptor subunit beta; IL-6R subunit beta; IL-6R-beta; IL-6RB; gp130
UniProt Entry Name
IL6RB_HUMAN

NCBI Description

The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggest that this gene plays a critical role in regulating myocyte apoptosis. Alternatively spliced transcript variants have been described. A related pseudogene has been identified on chromosome 17. [provided by RefSeq, May 2014]

Uniprot Description

gp130: gp130 is a ubiquitously expressed type I cytokine family receptor. The receptor systems for IL6, LIF, OSM, CNTF, IL11 AND CT1 utilize gp130 for initiating signal transmission. Binds to IL6/IL6R (alpha chain) complex, resulting in the formation of high-affinity IL6 binding sites, and transduces the signal. Does not directly bind IL6. May have a role in embryonic development. Contains 5 fibronectin type III domains and 1 immunoglobulin-like C2-type domain. Two alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 5q11.2

Cellular Component: extracellular space; cell soma; membrane; oncostatin-M receptor complex; dendrite; plasma membrane; extracellular region; interleukin-6 receptor complex; external side of plasma membrane

Molecular Function: interleukin-11 binding; protein homodimerization activity; interleukin-27 receptor activity; leukemia inhibitory factor receptor activity; oncostatin-M receptor activity; interleukin-6 receptor activity; interleukin-11 receptor activity; protein binding; interleukin-6 receptor binding; interleukin-6 binding; growth factor binding; ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding

Biological Process: glycogen metabolic process; viral reproduction; cytokine and chemokine mediated signaling pathway; leukemia inhibitory factor signaling pathway; positive regulation of tyrosine phosphorylation of Stat3 protein; positive regulation of osteoblast differentiation; positive regulation of tyrosine phosphorylation of Stat1 protein; regulation of Notch signaling pathway; positive regulation of acute inflammatory response; response to cytokine stimulus; positive regulation of cell proliferation; positive regulation of T cell proliferation; positive regulation of adaptive immune response; positive regulation of astrocyte differentiation; negative regulation of apoptosis

Research Articles on IL6ST

Similar Products

Product Notes

The IL6ST il6st (Catalog #AAA6153078) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL6ST (Interleukin-6 Receptor Subunit beta, IL-6R-beta, Interleukin-6 Signal Transducer, Membrane Glycoprotein 130, gp130, CDw130, Oncostatin-M Receptor Subunit alpha, CD130, IL-6 Receptor Subunit beta, IL-6R Subunit beta) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL6ST can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL6ST il6st for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL6ST, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.